spacer

EBI Dbfetch

ID   AY831401; SV 1; linear; mRNA; STD; HUM; 927 BP.
XX
AC   AY831401;
XX
DT   14-FEB-2005 (Rel. 82, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Homo sapiens MHC class II antigen (HLA-DPB1) mRNA, HLA-DPB1*1301 new
DE   allele, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-927
RX   DOI; 10.1007/s00251-005-0043-8.
RX   PUBMED; 16189666.
RA   Reinders J., Rozemuller E.H., van Gent R., Arts-Hilkes Y.H.,
RA   van den Tweel J.G., Tilanus M.G.;
RT   "Extended HLA-DPB1 polymorphism: an RNA approach for HLA-DPB1 typing";
RL   Immunogenetics 57(10):790-794(2005).
XX
RN   [2]
RP   1-927
RA   Reinders J., van Gent R., Rozemuller E.H., Tilanus M.G.J.;
RT   ;
RL   Submitted (19-NOV-2004) to the INSDC.
RL   Department of Pathology, H04.312, UMC Utrecht, Heidelberglaan 100, P.O. Box
RL   85500, Utrecht 3508 GA, The Netherlands
XX
DR   MD5; 93d663081022e7ea0e199865b047dd89.
DR   Ensembl-Gn; ENSG00000215048; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223865; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226826; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230763; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236693; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237710; homo_sapiens.
DR   Ensembl-Tr; ENST00000399500; homo_sapiens.
DR   Ensembl-Tr; ENST00000411749; homo_sapiens.
DR   Ensembl-Tr; ENST00000418931; homo_sapiens.
DR   Ensembl-Tr; ENST00000425130; homo_sapiens.
DR   Ensembl-Tr; ENST00000433800; homo_sapiens.
DR   Ensembl-Tr; ENST00000454006; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..927
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="mRNA"
FT                   /cell_line="IHW09076; T7526"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>927
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*1301 new"
FT   5'UTR           <1..48
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*1301 new"
FT   CDS             49..825
FT                   /codon_start=1
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*1301 new"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:P04440"
FT                   /db_xref="H-InvDB:HIT000257873.13"
FT                   /db_xref="HGNC:HGNC:4940"
FT                   /db_xref="IMGT/HLA:DPB1*107:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:3LQZ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P04440"
FT                   /protein_id="AAW80919.1"
FT                   /translation="MMVLQVSAAPRTVALMALLMVLLTSVVQGRATPENYVYQLRQECY
FT                   AFNGTQRFLERYIYNREEYARFDSDVGEFRAVTELGRPAAEYWNSQKDILEEERAVPDR
FT                   ICRHNYELDEAVTLQRRVQPKVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQ
FT                   EETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDVYICQVEHTSLDSPVTVEWKAQSDSA
FT                   RSKTLTGAGGFVLGLIICGVGIFMHRRSKKVQRGSA"
FT   3'UTR           826..>927
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*1301 new"
XX
SQ   Sequence 927 BP; 208 A; 251 C; 276 G; 192 T; 0 other;
     cttttcctga ctgcagctct tttcattttg ccaccctttt ccagctccat gatggttctg        60
     caggtttctg cagccccccg gacagtggct ctgatggcgt tactgatggt gctgctcaca       120
     tctgtggtcc agggcagggc cactccagag aattacgtgt accagttacg gcaggaatgc       180
     tacgcgttta atgggacaca gcgcttcctg gagagataca tctacaaccg ggaggagtac       240
     gcgcgcttcg acagcgacgt gggggagttc cgggcggtga cggagctggg gcggcctgct       300
     gcggagtact ggaacagcca gaaggacatc ctggaggagg agcgggcagt gccggacagg       360
     atatgcagac acaactacga gctggacgag gccgtgaccc tgcagcgccg agtccagcct       420
     aaggtgaacg tttccccctc caagaagggg cccctgcagc accacaacct gcttgtctgc       480
     cacgtgacag atttctaccc aggcagcatt caagtccgat ggttcctgaa tggacaggag       540
     gaaacagctg gggtcgtgtc caccaacctg atccgtaatg gagactggac cttccagatc       600
     ctggtgatgc tggaaatgac cccccagcag ggagacgtct acatctgcca agtggagcac       660
     accagcctgg acagtcctgt caccgtggag tggaaggcac agtctgattc tgcccggagt       720
     aagacattga cgggagctgg gggcttcgtg ctggggctca tcatctgtgg agtgggcatc       780
     ttcatgcaca ggaggagcaa gaaagttcaa cgaggatctg cataacaggg ttcctgacct       840
     caccgaaaag actaatgtgc cttagaacaa gcatttgctg tgttttgtta gcacctggtt       900
     ccaggacaga ccctcagctt cccaaga                                           927
//


spacer
spacer