spacer

EBI Dbfetch

ID   AY828236; SV 1; linear; genomic DNA; STD; ROD; 372 BP.
XX
AC   AY828236;
XX
DT   13-DEC-2004 (Rel. 82, Created)
DT   13-DEC-2004 (Rel. 82, Last updated, Version 1)
XX
DE   Lophuromys flavopunctatus clone FLA5 cytochrome b (cytb) gene, partial cds;
DE   mitochondrial.
XX
KW   .
XX
OS   Lophuromys flavopunctatus (yellow-spotted brush-furred rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Deomyinae; Lophuromys.
OG   Mitochondrion
XX
RN   [1]
RP   1-372
RA   Lavrenchenko L.A., Verheyen E., Potapov S.G., Lebedev V.S., Bulatova N.Sh.,
RA   Aniskin V.M., Verheyen W.N., Ryskov A.P.;
RT   "Divergent and reticulate processes in evolution of Ethiopian Lophuromys
RT   flavopunctatus species complex: evidence from mitochondrial and nuclear DNA
RT   differentiation patterns";
RL   Biol. J. Linn. Soc. Lond. 83:301-316(2004).
XX
RN   [2]
RP   1-372
RA   Lavrenchenko L.A., Verheyen E., Potapov S.G., Lebedev V.S., Bulatova N.Sh.,
RA   Aniskin V.M., Verheyen W.N., Ryskov A.P.;
RT   ;
RL   Submitted (16-NOV-2004) to the INSDC.
RL   Laboratory of Mammal Microevolution, Severtsov Institute of Ecology and
RL   Evolution RAS, 33 Leninsky Prospect, Moscow 119071, Russia
XX
DR   MD5; 753c13fad75bfa55857f57d0dca03dca.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..372
FT                   /organism="Lophuromys flavopunctatus"
FT                   /organelle="mitochondrion"
FT                   /mol_type="genomic DNA"
FT                   /country="Ethiopia"
FT                   /haplotype="Menagesha"
FT                   /clone="FLA5"
FT                   /db_xref="taxon:51348"
FT   gene            <1..>372
FT                   /gene="cytb"
FT   CDS             <1..>372
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /gene="cytb"
FT                   /product="cytochrome b"
FT                   /db_xref="GOA:Q5MI90"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="UniProtKB/TrEMBL:Q5MI90"
FT                   /protein_id="AAV86090.1"
FT                   /translation="IKIINHSFIDLPAPSNISSWWNFGSLLGICLIIQIATGLFLAMHY
FT                   TSDTATAFTSVTHICRDVNYGWLIRYLHANGASMFFICLFLHVGRGIYYGSYTFIETWN
FT                   IGIILLFTVMATAFMGYVLP"
XX
SQ   Sequence 372 BP; 101 A; 115 C; 50 G; 106 T; 0 other;
     atcaaaatta tcaatcactc attcatcgac ctccctgccc cctccaacat ctcatcctga        60
     tgaaactttg gctccttact aggcatctgc ctcattattc aaatcgccac aggccttttc       120
     ctagctatac attacacctc cgacaccgca acagcattca catccgtcac acacatctgc       180
     cgagacgtaa attacggctg actaatccgc tatctccacg caaacggagc ctccatattt       240
     ttcatttgcc tgttcctaca cgtaggccga ggaatttact acggctccta caccttcatt       300
     gaaacatgga acattggaat tatcctacta tttactgtaa tagcaactgc attcataggt       360
     tatgtacttc ca                                                           372
//


spacer
spacer