Dbfetch

ID   AY823995; SV 1; linear; genomic DNA; STD; HUM; 267 BP.
XX
AC   AY823995;
XX
DT   11-FEB-2005 (Rel. 82, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens MHC class II antigen (HLA-DPB1) gene, HLA-DPB1*0403. allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-267
RX   DOI; 10.1080/10425170500061442.
RX   PUBMED; 16147881.
RA   Weston A., Ensey J.S., Frye B.L.;
RT   "DNA-sequence determination of exon 2 of a novel HLA-DPB1 allele,
RT   HLA-DPB1*0403";
RL   DNA Seq 16(3):235-236(2005).
XX
RN   [2]
RP   1-267
RA   Weston A., Ensey J.S., Frye B.L.;
RT   ;
RL   Submitted (12-NOV-2004) to the INSDC.
RL   TMBB/HELD, National Institute for Occupational Safety and Health (NIOSH),
RL   1095 Willowdale Road, Morgantown, WV 26505, USA
XX
DR   MD5; c26cb2c43bc78389f5b4be6299d3c9ec.
DR   Ensembl-Gn; ENSG00000215048; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223865; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226826; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230763; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236693; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237710; homo_sapiens.
DR   Ensembl-Tr; ENST00000399500; homo_sapiens.
DR   Ensembl-Tr; ENST00000411749; homo_sapiens.
DR   Ensembl-Tr; ENST00000418931; homo_sapiens.
DR   Ensembl-Tr; ENST00000425130; homo_sapiens.
DR   Ensembl-Tr; ENST00000433800; homo_sapiens.
DR   Ensembl-Tr; ENST00000454006; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..267
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="peripheral blood white cells"
FT                   /note="from an African-American"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>267
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*0403."
FT   CDS             <1..>267
FT                   /codon_start=3
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*0403."
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:P04440"
FT                   /db_xref="HGNC:HGNC:4940"
FT                   /db_xref="IMGT/HLA:DPB1*103:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:3LQZ"
FT                   /db_xref="PDB:4P4K"
FT                   /db_xref="PDB:4P4R"
FT                   /db_xref="PDB:4P57"
FT                   /db_xref="PDB:4P5K"
FT                   /db_xref="PDB:4P5M"
FT                   /db_xref="UniProtKB/Swiss-Prot:P04440"
FT                   /protein_id="AAW79272.1"
FT                   /translation="ENYLFQGRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVT
FT                   ELGRPAAEYWNSQKDILEEERAVPDRMCRHNYELDEAVTLQRR"
FT   exon            1..267
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*0403."
FT                   /number=2
XX
SQ   Sequence 267 BP; 61 A; 66 C; 99 G; 41 T; 0 other;
     cagagaatta ccttttccag ggacggcagg aatgctacgc gtttaatggg acacagcgct        60
     tcctggagag atacatctac aaccgggagg agttcgtgcg cttcgacagc gacgtggggg       120
     agttccgggc ggtgacggag ctggggcggc ctgctgcgga gtactggaac agccagaagg       180
     acatcctgga ggaggagcgg gcagtgccgg acaggatgtg cagacacaac tacgagctgg       240
     acgaggccgt gaccctgcag cgccgag                                           267
//