Dbfetch

ID   AY804142; SV 1; linear; mRNA; STD; HUM; 927 BP.
XX
AC   AY804142;
XX
DT   09-FEB-2005 (Rel. 82, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Homo sapiens MHC class II antigen (HLA-DPB1) mRNA, HLA-DPB1-DPB1*1901
DE   allele, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-927
RX   DOI; 10.1007/s00251-005-0043-8.
RX   PUBMED; 16189666.
RA   Reinders J., Rozemuller E.H., van Gent R., Arts-Hilkes Y.H.,
RA   van den Tweel J.G., Tilanus M.G.;
RT   "Extended HLA-DPB1 polymorphism: an RNA approach for HLA-DPB1 typing";
RL   Immunogenetics 57(10):790-794(2005).
XX
RN   [2]
RP   1-927
RA   Reinders J., van Gent R., Rozemuller E.H., Tilanus M.G.J.;
RT   ;
RL   Submitted (01-NOV-2004) to the INSDC.
RL   Department of Pathology, H04.312, UMC Utrecht, Heidelberglaan 100, P.O. Box
RL   85500, Utrecht 3508 GA, The Netherlands
XX
DR   MD5; fb97f8ba125d86c93f8dd14ed2614cd0.
DR   Ensembl-Gn; ENSG00000215048; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223865; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226826; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230763; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236693; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237710; homo_sapiens.
DR   Ensembl-Tr; ENST00000399500; homo_sapiens.
DR   Ensembl-Tr; ENST00000411749; homo_sapiens.
DR   Ensembl-Tr; ENST00000418931; homo_sapiens.
DR   Ensembl-Tr; ENST00000425130; homo_sapiens.
DR   Ensembl-Tr; ENST00000433800; homo_sapiens.
DR   Ensembl-Tr; ENST00000454006; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..927
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="mRNA"
FT                   /cell_line="IHW09060, CB6B"
FT                   /db_xref="taxon:9606"
FT   gene            1..927
FT                   /gene="HLA-DPB1"
FT                   /allele="DPB1*1901"
FT   CDS             48..824
FT                   /codon_start=1
FT                   /gene="HLA-DPB1"
FT                   /allele="DPB1*1901"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:P04440"
FT                   /db_xref="H-InvDB:HIT000257828.13"
FT                   /db_xref="HGNC:HGNC:4940"
FT                   /db_xref="IMGT/HLA:DPB1*19:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:3LQZ"
FT                   /db_xref="PDB:4P4K"
FT                   /db_xref="PDB:4P4R"
FT                   /db_xref="PDB:4P57"
FT                   /db_xref="PDB:4P5K"
FT                   /db_xref="PDB:4P5M"
FT                   /db_xref="UniProtKB/Swiss-Prot:P04440"
FT                   /protein_id="AAW78747.1"
FT                   /translation="MMVLQVSAAPRTVALTALLMVLLTSVVQGRATPENYLFQGRQECY
FT                   AFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTELGRPEAEYWNSQKDILEEERAVPDR
FT                   ICRHNYELDEAVTLQRRVQPKVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQ
FT                   EETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDVYICQVEHTSLDSPVTVEWKAQSDSA
FT                   RSKTLTGAGGFMLGLIICGVGIFMHRRSKKVQRGSA"
XX
SQ   Sequence 927 BP; 208 A; 249 C; 277 G; 193 T; 0 other;
     ttttcctgac tgcagctctt ttcattttgc catccttttc cagctccatg atggttctgc        60
     aggtttctgc ggccccccgg acagtggctc tgacggcgtt actgatggtg ctgctcacat       120
     ctgtggtcca gggcagggcc actccagaga attacctttt ccagggacgg caggaatgct       180
     acgcgtttaa tgggacacag cgcttcctgg agagatacat ctacaaccgg gaggagttcg       240
     tgcgcttcga cagcgacgtg ggggagttcc gggcggtgac ggagctgggg cggcctgagg       300
     cggagtactg gaacagccag aaggacatcc tggaggagga gcgggcagtg ccggacagga       360
     tatgcagaca caactacgag ctggacgagg ccgtgaccct gcagcgccga gtccagccta       420
     aggtgaacgt ttccccctcc aagaaggggc ccctgcagca ccacaacctg cttgtctgcc       480
     acgtgacaga tttctaccca ggcagcattc aagtccgatg gttcctgaat ggacaggagg       540
     aaacagctgg ggtcgtgtcc accaacctga tccgtaatgg agactggacc ttccagatcc       600
     tggtgatgct ggaaatgacc ccccagcagg gagacgtcta catctgccaa gtggagcaca       660
     ccagcctgga cagtcctgtc accgtggagt ggaaggcaca gtctgattct gcccggagta       720
     agacattgac gggagctggg ggcttcatgc tggggctcat catctgtgga gtgggcatct       780
     tcatgcacag gaggagcaag aaagttcaac gaggatctgc ataaacaggg ttcctgacct       840
     caccgaaaag actaatgtgc cttagaacaa gcatttgctg tgttttgtta gcacctggtt       900
     ccaggacaga ccctcagctt cccaaga                                           927
//