spacer

EBI Dbfetch

ID   AY804141; SV 1; linear; mRNA; STD; HUM; 893 BP.
XX
AC   AY804141;
XX
DT   09-FEB-2005 (Rel. 82, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Homo sapiens MHC class II antigen (HLA-DPB1) mRNA, HLA-DPB1-DPB1*1501
DE   allele, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-893
RX   DOI; 10.1007/s00251-005-0043-8.
RX   PUBMED; 16189666.
RA   Reinders J., Rozemuller E.H., van Gent R., Arts-Hilkes Y.H.,
RA   van den Tweel J.G., Tilanus M.G.;
RT   "Extended HLA-DPB1 polymorphism: an RNA approach for HLA-DPB1 typing";
RL   Immunogenetics 57(10):790-794(2005).
XX
RN   [2]
RP   1-893
RA   Reinders J., van Gent R., Rozemuller E.H., Tilanus M.G.J.;
RT   ;
RL   Submitted (01-NOV-2004) to the INSDC.
RL   Department of Pathology, H04.312, UMC Utrecht, Heidelberglaan 100, P.O. Box
RL   85500, Utrecht 3508 GA, The Netherlands
XX
DR   MD5; 597993d19147771723fcfb6905a19d5e.
DR   Ensembl-Gn; ENSG00000215048; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223865; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226826; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230763; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236693; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237710; homo_sapiens.
DR   Ensembl-Tr; ENST00000399500; homo_sapiens.
DR   Ensembl-Tr; ENST00000411749; homo_sapiens.
DR   Ensembl-Tr; ENST00000418931; homo_sapiens.
DR   Ensembl-Tr; ENST00000425130; homo_sapiens.
DR   Ensembl-Tr; ENST00000433800; homo_sapiens.
DR   Ensembl-Tr; ENST00000454006; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..893
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="mRNA"
FT                   /cell_line="IHW09047, PLH"
FT                   /db_xref="taxon:9606"
FT   gene            1..893
FT                   /gene="HLA-DPB1"
FT                   /allele="DPB1*1501"
FT   CDS             24..800
FT                   /codon_start=1
FT                   /gene="HLA-DPB1"
FT                   /allele="DPB1*1501"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:P04440"
FT                   /db_xref="H-InvDB:HIT000257827.13"
FT                   /db_xref="HGNC:HGNC:4940"
FT                   /db_xref="IMGT/HLA:DPB1*15:01:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:3LQZ"
FT                   /db_xref="PDB:4P4K"
FT                   /db_xref="PDB:4P4R"
FT                   /db_xref="PDB:4P57"
FT                   /db_xref="UniProtKB/Swiss-Prot:P04440"
FT                   /protein_id="AAW78746.1"
FT                   /translation="MMVLQVSAAPRTVALTALLMVLLTSVVQGRATPENYVYQGRQECY
FT                   AFNGTQRFLERYIYNRQEYARFDSDVGEFRAVTELGRPAAEYWNSQKDLLEERRAVPDR
FT                   MCRHNYELVGPMTLQRRVQPKVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQ
FT                   EETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDVYICQVEHTSLDSPVTVEWKAQSDSA
FT                   RSKTLTGAGGFVLGLIICGVGTFMHRRSKKVQRGSA"
XX
SQ   Sequence 893 BP; 200 A; 242 C; 273 G; 178 T; 0 other;
     ttttgccatc cttttccagc tccatgatgg ttctgcaggt ttctgcggcc ccccggacag        60
     tggctctgac ggcgttactg atggtgctgc tcacatctgt ggtccagggc agggccactc       120
     cagagaatta cgtgtaccag ggacggcagg aatgctacgc gtttaatggg acacagcgct       180
     tcctggagag atacatctac aaccggcagg agtacgcgcg cttcgacagc gacgtgggag       240
     agttccgggc ggtgacggag ctggggcggc ctgctgcgga gtactggaac agccagaagg       300
     acctcctgga ggagaggcgg gcagtgccgg acaggatgtg cagacacaac tacgagctgg       360
     tcgggcccat gaccctgcag cgccgagtcc agcctaaggt gaacgtttcc ccctccaaga       420
     aggggcccct gcagcaccac aacctgcttg tctgccacgt gacagatttc tacccaggca       480
     gcattcaagt ccgatggttc ctgaatggac aggaggaaac agctggggtc gtgtccacca       540
     acctgatccg taatggagac tggaccttcc agatcctggt gatgctggaa atgacccccc       600
     agcagggaga cgtctacatc tgccaagtgg agcacaccag cctggacagt cctgtcactg       660
     tggagtggaa ggcacagtct gattctgccc ggagtaagac attgacggga gctgggggct       720
     tcgtgctggg gctcatcatc tgtggagtgg gcaccttcat gcacaggagg agcaagaaag       780
     ttcaacgagg atctgcataa acagggttcc tgacctcacc gaaaagacta atgtgcctta       840
     gaacaagcat ttgctgtgtt ttgttagcac ctggttccag gacagaccct cag              893
//


spacer
spacer