Dbfetch

ID   AY804140; SV 1; linear; mRNA; STD; HUM; 906 BP.
XX
AC   AY804140;
XX
DT   09-FEB-2005 (Rel. 82, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Homo sapiens MHC class II antigen (HLA-DPB1) mRNA, HLA-DPB1-DPB1*1401
DE   allele, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-906
RX   DOI; 10.1007/s00251-005-0043-8.
RX   PUBMED; 16189666.
RA   Reinders J., Rozemuller E.H., van Gent R., Arts-Hilkes Y.H.,
RA   van den Tweel J.G., Tilanus M.G.;
RT   "Extended HLA-DPB1 polymorphism: an RNA approach for HLA-DPB1 typing";
RL   Immunogenetics 57(10):790-794(2005).
XX
RN   [2]
RP   1-906
RA   Reinders J., van Gent R., Rozemuller E.H., Tilanus M.G.J.;
RT   ;
RL   Submitted (01-NOV-2004) to the INSDC.
RL   Department of Pathology, H04.312, UMC Utrecht, Heidelberglaan 100, P.O. Box
RL   85500, Utrecht 3508 GA, The Netherlands
XX
DR   MD5; bc3bba43635352a125bfd007de52859d.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..906
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="mRNA"
FT                   /cell_line="IHW09376, FH4"
FT                   /db_xref="taxon:9606"
FT   gene            1..906
FT                   /gene="HLA-DPB1"
FT                   /allele="DPB1*1401"
FT   CDS             39..815
FT                   /codon_start=1
FT                   /gene="HLA-DPB1"
FT                   /allele="DPB1*1401"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q5EP48"
FT                   /db_xref="H-InvDB:HIT000257826.13"
FT                   /db_xref="IMGT/HLA:DPB1*14:01:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q5EP48"
FT                   /protein_id="AAW78745.1"
FT                   /translation="MMVLQVSAAPRTVALTALLMVLLTSVVQGRATPENYVHQLRQECY
FT                   AFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTELGRPDEDYWNSQKDLLEEKRAVPDR
FT                   VCRHNYELDEAVTLQRRVQPKVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQ
FT                   EETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDVYICQVEHTSLDSPVTVEWKAQSDSA
FT                   RSKTLTGAGGFVLGLIICGVGIFMHRRSKKVQRGSA"
XX
SQ   Sequence 906 BP; 203 A; 244 C; 273 G; 186 T; 0 other;
     ctgcagctct tttcattttg ccatcctttt ccagctccat gatggttctg caggtttctg        60
     cggccccccg gacagtggct ctgacggcgt tactgatggt gctgctcaca tctgtggtcc       120
     agggcagggc cactccagag aattacgtgc accagttacg gcaggaatgc tacgcgttta       180
     atgggacaca gcgcttcctg gagagataca tctacaaccg ggaggagttc gtgcgcttcg       240
     acagcgacgt gggggagttc cgggcggtga cggagctggg gcggcctgat gaggactact       300
     ggaacagcca gaaggacctc ctggaggaga agcgggcagt gccggacagg gtatgcagac       360
     acaactacga gctggacgag gccgtgaccc tgcagcgccg agtccagcct aaggtgaacg       420
     tttccccctc caagaagggg cccctgcagc accacaacct gcttgtctgc cacgtgacag       480
     atttctaccc aggcagcatt caagtccgat ggttcctgaa tggacaggag gaaacagctg       540
     gggtcgtgtc caccaacctg atccgtaatg gagactggac cttccagatc ctggtgatgc       600
     tggaaatgac cccccagcag ggagacgtct acatctgcca agtggagcac accagcctgg       660
     acagtcctgt caccgtggag tggaaggcac agtctgattc tgcccggagt aagacattga       720
     cgggagctgg gggcttcgtg ctggggctca tcatctgtgg agtgggcatc ttcatgcaca       780
     ggaggagcaa gaaagttcaa cgaggatctg cataaacagg gttcctgacc tcaccgaaaa       840
     gactaatgtg ccttagaaca agcatttgct gtgttttgtt agcacctggt tccaggacag       900
     accctc                                                                  906
//