Dbfetch

ID   AY804137; SV 1; linear; mRNA; STD; HUM; 917 BP.
XX
AC   AY804137;
XX
DT   09-FEB-2005 (Rel. 82, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Homo sapiens MHC class II antigen (HLA-DPB1) mRNA, HLA-DPB1-DPB1*0402new
DE   allele, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-917
RX   DOI; 10.1007/s00251-005-0043-8.
RX   PUBMED; 16189666.
RA   Reinders J., Rozemuller E.H., van Gent R., Arts-Hilkes Y.H.,
RA   van den Tweel J.G., Tilanus M.G.;
RT   "Extended HLA-DPB1 polymorphism: an RNA approach for HLA-DPB1 typing";
RL   Immunogenetics 57(10):790-794(2005).
XX
RN   [2]
RP   1-917
RA   Reinders J., van Gent R., Rozemuller E.H., Tilanus M.G.J.;
RT   ;
RL   Submitted (01-NOV-2004) to the INSDC.
RL   Department of Pathology, H04.312, UMC Utrecht, Heidelberglaan 100, P.O. Box
RL   85500, Utrecht 3508 GA, The Netherlands
XX
DR   MD5; 0161e3b0e582d3733620c415685c7274.
DR   Ensembl-Gn; ENSG00000215048; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223865; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226826; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230763; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236693; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237710; homo_sapiens.
DR   Ensembl-Tr; ENST00000399500; homo_sapiens.
DR   Ensembl-Tr; ENST00000411749; homo_sapiens.
DR   Ensembl-Tr; ENST00000418931; homo_sapiens.
DR   Ensembl-Tr; ENST00000425130; homo_sapiens.
DR   Ensembl-Tr; ENST00000433800; homo_sapiens.
DR   Ensembl-Tr; ENST00000454006; homo_sapiens.
DR   H-InvDB; HIT000257823_03.4.
DR   H-InvDB; HIT000257823_04.4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..917
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="mRNA"
FT                   /cell_line="IHW09021, RSH"
FT                   /db_xref="taxon:9606"
FT   gene            1..917
FT                   /gene="HLA-DPB1"
FT                   /allele="DPB1*0402new"
FT   CDS             38..814
FT                   /codon_start=1
FT                   /gene="HLA-DPB1"
FT                   /allele="DPB1*0402new"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:P04440"
FT                   /db_xref="H-InvDB:HIT000257823_02.4"
FT                   /db_xref="HGNC:HGNC:4940"
FT                   /db_xref="IMGT/HLA:DPB1*105:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="PDB:3LQZ"
FT                   /db_xref="PDB:4P4K"
FT                   /db_xref="PDB:4P4R"
FT                   /db_xref="PDB:4P57"
FT                   /db_xref="PDB:4P5K"
FT                   /db_xref="PDB:4P5M"
FT                   /db_xref="UniProtKB/Swiss-Prot:P04440"
FT                   /protein_id="AAW78742.1"
FT                   /translation="MMVLQVSAAPRTVALTALLMVLLTSVVQGRATPENYLFQGRQECY
FT                   AFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTELGRPDEEYWNSQKDILEEKRAVPDR
FT                   MCRHNYELGGPMTLQRRVQPRVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQ
FT                   EETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDVYTCQVEHTSLDSPVTVEWKAQSDSA
FT                   RSKTLTGAGGFVLGLIICGVGIFMHRRSKKVQRGSA"
XX
SQ   Sequence 917 BP; 204 A; 239 C; 278 G; 196 T; 0 other;
     tgcagctctt ttcattttgc catccttttc cagctccatg atggttctgc aggtttctgc        60
     ggccccccgg acagtggctc tgacggcgtt actgatggtg ctgctcacat ctgtggtcca       120
     gggcagggcc actccagaga attacctttt ccagggacgg caggaatgct acgcgtttaa       180
     tgggacacag cgcttcctgg agagatacat ctacaaccgg gaggagttcg tgcgcttcga       240
     cagcgacgtg ggggagttcc gggcggtgac ggagctgggg cggcctgatg aggagtactg       300
     gaacagccag aaggacatcc tggaggagaa gcgggcagtg ccggacagga tgtgcagaca       360
     caactacgag ctgggcgggc ccatgaccct gcagcgccga gtccagccta gggtgaatgt       420
     ttccccctcc aagaaggggc ccttgcagca ccacaacctg cttgtctgcc acgtgacgga       480
     tttctaccca ggcagcattc aagtccgatg gttcctgaat ggacaggagg aaacagctgg       540
     ggtcgtgtcc accaacctga tccgtaatgg agactggacc ttccagatcc tggtgatgct       600
     ggaaatgacc ccccagcagg gagatgtcta cacctgccaa gtggagcaca ccagcctgga       660
     tagtcctgtc accgtggagt ggaaggcaca gtctgattct gcccggagta agacattgac       720
     gggagctggg ggcttcgtgc tggggctcat catctgtgga gtgggcatct tcatgcacag       780
     gaggagcaag aaagttcaac gaggatctgc ataaacaggg ttcctgagct cactgaaaag       840
     actattgtgc cttaggaaaa gcatttgctg tgtttcgtta gcatctggct ccaggacaga       900
     ccttcaactt ccaaatt                                                      917
//