spacer

EBI Dbfetch

ID   AY804135; SV 1; linear; mRNA; STD; HUM; 907 BP.
XX
AC   AY804135;
XX
DT   09-FEB-2005 (Rel. 82, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Homo sapiens MHC class II antigen (HLA-DPB1) mRNA, HLA-DPB1-DPB1*030101new
DE   allele, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-907
RX   DOI; 10.1007/s00251-005-0043-8.
RX   PUBMED; 16189666.
RA   Reinders J., Rozemuller E.H., van Gent R., Arts-Hilkes Y.H.,
RA   van den Tweel J.G., Tilanus M.G.;
RT   "Extended HLA-DPB1 polymorphism: an RNA approach for HLA-DPB1 typing";
RL   Immunogenetics 57(10):790-794(2005).
XX
RN   [2]
RP   1-907
RA   Reinders J., van Gent R., Rozemuller E.H., Tilanus M.G.J.;
RT   ;
RL   Submitted (01-NOV-2004) to the INSDC.
RL   Department of Pathology, H04.312, UMC Utrecht, Heidelberglaan 100, P.O. Box
RL   85500, Utrecht 3508 GA, The Netherlands
XX
DR   MD5; ebdb6f03e470d6430bfff0dc08e49616.
DR   Ensembl-Gn; ENSG00000215048; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223865; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226826; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230763; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236693; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237710; homo_sapiens.
DR   Ensembl-Tr; ENST00000399500; homo_sapiens.
DR   Ensembl-Tr; ENST00000411749; homo_sapiens.
DR   Ensembl-Tr; ENST00000418931; homo_sapiens.
DR   Ensembl-Tr; ENST00000425130; homo_sapiens.
DR   Ensembl-Tr; ENST00000433800; homo_sapiens.
DR   Ensembl-Tr; ENST00000454006; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..907
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="mRNA"
FT                   /cell_line="IHW09366, Daudi"
FT                   /db_xref="taxon:9606"
FT   gene            1..907
FT                   /gene="HLA-DPB1"
FT                   /allele="DPB1*030101new"
FT   CDS             38..814
FT                   /codon_start=1
FT                   /gene="HLA-DPB1"
FT                   /allele="DPB1*030101new"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:P04440"
FT                   /db_xref="H-InvDB:HIT000257821.13"
FT                   /db_xref="HGNC:HGNC:4940"
FT                   /db_xref="IMGT/HLA:DPB1*104:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:3LQZ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P04440"
FT                   /protein_id="AAW78740.1"
FT                   /translation="MMVLQVSAAPRTVALTALLMVLLTSVVQGRATPENYVYQLRQECY
FT                   AFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTELGRPDEDYWNSQKDLLEEKRAVPDR
FT                   VCRHNYELDEAVTLQRRVQPKVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQ
FT                   EETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDVYICQVEHTSLDSPVTVEWKAQSDSA
FT                   RSKTLTGAGGFMLGLIICGVGIFMHRRSKKVQRGSA"
XX
SQ   Sequence 907 BP; 205 A; 242 C; 273 G; 187 T; 0 other;
     tgcagctctt ttcattttgc catccttttc cagctccatg atggttctgc aggtttctgc        60
     ggccccccgg acagtggctc tgacggcgtt actgatggtg ctgctcacat ctgtggtcca       120
     gggcagggcc actccagaga attacgtgta ccagttacgg caggaatgct acgcgtttaa       180
     tgggacacag cgcttcctgg agagatacat ctacaaccgg gaggagttcg tgcgcttcga       240
     cagcgacgtg ggggagttcc gggcggtgac ggagctgggg cggcctgatg aggactactg       300
     gaacagccag aaggacctcc tggaggagaa gcgggcagtg ccggacaggg tatgcagaca       360
     caactacgag ctggacgagg ccgtgaccct gcagcgccga gtccagccta aggtgaacgt       420
     ttccccctcc aagaaggggc ccctgcagca ccacaacctg cttgtctgcc acgtgacaga       480
     tttctaccca ggcagcattc aagtccgatg gttcctgaat ggacaggagg aaacagctgg       540
     ggtcgtgtcc accaacctga tccgtaatgg agactggacc ttccagatcc tggtgatgct       600
     ggaaatgacc ccccagcagg gagacgtcta catctgccaa gtggagcaca ccagcctgga       660
     cagtcctgtc accgtggagt ggaaggcaca gtctgattct gcccggagta agacattgac       720
     gggagctggg ggcttcatgc tggggctcat catctgtgga gtgggcatct tcatgcacag       780
     gaggagcaag aaagttcaac gaggatctgc ataaacaggg ttcctgacct caccgaaaag       840
     actaatgtgc cttagaacaa gcatttgctg tgttttgtta gcacctggtt ccaggacaga       900
     ccctcag                                                                 907
//


spacer
spacer