Dbfetch

ID   AY804133; SV 1; linear; mRNA; STD; HUM; 813 BP.
XX
AC   AY804133;
XX
DT   09-FEB-2005 (Rel. 82, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Homo sapiens MHC class II antigen (HLA-DPB1) mRNA, HLA-DPB1-DPB1*010102
DE   allele, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-813
RX   DOI; 10.1007/s00251-005-0043-8.
RX   PUBMED; 16189666.
RA   Reinders J., Rozemuller E.H., van Gent R., Arts-Hilkes Y.H.,
RA   van den Tweel J.G., Tilanus M.G.;
RT   "Extended HLA-DPB1 polymorphism: an RNA approach for HLA-DPB1 typing";
RL   Immunogenetics 57(10):790-794(2005).
XX
RN   [2]
RP   1-813
RA   Reinders J., van Gent R., Rozemuller E.H., Tilanus M.G.J.;
RT   ;
RL   Submitted (01-NOV-2004) to the INSDC.
RL   Department of Pathology, H04.312, UMC Utrecht, Heidelberglaan 100, P.O. Box
RL   85500, Utrecht 3508 GA, The Netherlands
XX
DR   MD5; 8178148a55d770a3b26878ccdd133750.
DR   Ensembl-Gn; ENSG00000215048; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223865; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226826; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230763; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236693; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237710; homo_sapiens.
DR   Ensembl-Tr; ENST00000399500; homo_sapiens.
DR   Ensembl-Tr; ENST00000411749; homo_sapiens.
DR   Ensembl-Tr; ENST00000418931; homo_sapiens.
DR   Ensembl-Tr; ENST00000425130; homo_sapiens.
DR   Ensembl-Tr; ENST00000433800; homo_sapiens.
DR   Ensembl-Tr; ENST00000454006; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..813
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="mRNA"
FT                   /cell_line="IHW09049, IBW9"
FT                   /db_xref="taxon:9606"
FT   gene            1..813
FT                   /gene="HLA-DPB1"
FT                   /allele="DPB1*010102"
FT   CDS             10..786
FT                   /codon_start=1
FT                   /gene="HLA-DPB1"
FT                   /allele="DPB1*010102"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:P04440"
FT                   /db_xref="H-InvDB:HIT000257819.13"
FT                   /db_xref="HGNC:HGNC:4940"
FT                   /db_xref="IMGT/HLA:DPB1*01:01:02"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:3LQZ"
FT                   /db_xref="PDB:4P4K"
FT                   /db_xref="PDB:4P4R"
FT                   /db_xref="PDB:4P57"
FT                   /db_xref="PDB:4P5K"
FT                   /db_xref="PDB:4P5M"
FT                   /db_xref="UniProtKB/Swiss-Prot:P04440"
FT                   /protein_id="AAW78738.1"
FT                   /translation="MMVLQVSAAPRTVALTALLMVLLTSVVQGRATPENYVYQGRQECY
FT                   AFNGTQRFLERYIYNREEYARFDSDVGEFRAVTELGRPAAEYWNSQKDILEEKRAVPDR
FT                   VCRHNYELDEAVTLQRRVQPKVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQ
FT                   EETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDVYICQVEHTSLDSPVTVEWKAQSDSA
FT                   QSKTLTGAGGFVLGLIICGVGIFMHRRSKKVQRGSA"
XX
SQ   Sequence 813 BP; 188 A; 219 C; 257 G; 149 T; 0 other;
     tccagctcca tgatggttct gcaggtttct gcggcccccc ggacagtggc tctgacggcg        60
     ttactgatgg tgctgctcac atctgtggtc cagggcaggg ccactccaga gaattacgtg       120
     taccagggac ggcaggaatg ctacgcgttt aatgggacac agcgcttcct ggagagatac       180
     atctacaacc gggaggagta cgcgcgcttc gacagcgacg tgggagagtt ccgggcggtg       240
     acggagctgg ggcggcctgc tgcggagtac tggaacagcc agaaggacat cctggaggag       300
     aagcgggcag tgccggacag ggtatgcaga cacaactacg agctggacga ggccgtgacc       360
     ctgcagcgcc gagtccagcc taaggtgaac gtttccccct ccaagaaggg gcccctgcag       420
     caccacaacc tgcttgtctg ccacgtgaca gatttctacc caggcagcat tcaagtccga       480
     tggttcctga atggacagga ggaaacagct ggggtcgtgt ccaccaacct gatccgtaat       540
     ggagactgga ccttccagat cctggtgatg ctggaaatga ccccccagca gggagacgtc       600
     tacatctgcc aagtggagca caccagcctg gacagtcctg tcaccgtgga gtggaaggca       660
     cagtctgatt ctgcccagag taagacattg acgggagctg ggggcttcgt gctggggctc       720
     atcatctgtg gagtgggcat cttcatgcac aggaggagca agaaagttca acgaggatct       780
     gcataaacag ggttcctgac ctcaccgaaa aga                                    813
//