spacer

EBI Dbfetch

ID   AY796420; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   AY796420;
XX
DT   06-FEB-2005 (Rel. 82, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*02 variant allele,
DE   exon 4 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RX   DOI; 10.1111/j.1399-0039.2005.00450.x.
RX   PUBMED; 16029435.
RA   Piancatelli D., Beato T.D., Papola F., Aureli A., Fioroni A., Canossi A.,
RA   Mastrangelo E., Liberatore G., Tessitore A., Adorno D.;
RT   "Identification of a novel HLA-A*02 allele, A*027401*";
RL   Tissue Antigens 66(2):138-140(2005).
XX
RN   [2]
RP   1-276
RA   Piancatelli D., Aureli A., Canossi A., Del Beato T., Papola F., Fioroni A.,
RA   Liberatore G., Mastrangelo E., Tessitore A., Adorno D.;
RT   ;
RL   Submitted (28-OCT-2004) to the INSDC.
RL   CNR- Istituto per i Trapianti d'Organo e l'Immunocitologia- Centro
RL   Regionale di Immunoematologia e Tipizzazione Tissutale, Piazzale
RL   Collemaggio, L'Aquila 67100, Italy
XX
DR   MD5; ce81db5abc51887626837e622d4c6bf3.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="F154"
FT                   /mol_type="genomic DNA"
FT                   /isolation_source="caucasoid individual; potential bone
FT                   marrow recipient"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   gene            order(AY796418.1:<1..270,AY796419.1:1..276,1..>276)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02 variant"
FT   mRNA            join(AY796418.1:<1..270,AY796419.1:1..276,1..>276)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(AY796418.1:<1..270,AY796419.1:1..276,1..>276)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q5EPE9"
FT                   /db_xref="IMGT/HLA:A*02:74:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q5EPE9"
FT                   /protein_id="AAW73085.1"
FT                   /translation="SHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGS
FT                   DWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTC
FT                   VEWLRRYLENRKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHVQHEGLPKPLTLRW"
FT   exon            1..276
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02 variant"
FT                   /number=4
XX
SQ   Sequence 276 BP; 60 A; 83 C; 88 G; 45 T; 0 other;
     acgcccccaa aacgcatatg actcaccacg ctgtctctga ccatgaagcc accctgaggt        60
     gctgggccct gagcttctac cctgcggaga tcacactgac ctggcagcgg gatggggagg       120
     accagaccca ggacacggag ctcgtggaga ccaggcctgc aggggatgga accttccaga       180
     agtgggcggc tgtggtggtg ccttctggac aggagcagag atacacctgc catgtgcagc       240
     atgagggttt gcccaagccc ctcaccctga gatggg                                 276
//


spacer
spacer