Dbfetch

ID   AH014627; SV 2; linear; genomic DNA; STD; HUM; 1022 BP.
XX
AC   AH014627; AY796418-AY796420;
XX
DT   07-APR-2016 (Rel. 128, Created)
DT   29-JUL-2016 (Rel. 129, Last updated, Version 2)
XX
DE   Homo sapiens chromosome 6 MHC class I antigen (HLA-A) gene, HLA-A*02
DE   variant allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1022
RX   DOI; 10.1111/j.1399-0039.2005.00450.x.
RX   PUBMED; 16029435.
RA   Piancatelli D., Beato T.D., Papola F., Aureli A., Fioroni A., Canossi A.,
RA   Mastrangelo E., Liberatore G., Tessitore A., Adorno D.;
RT   "Identification of a novel HLA-A*02 allele, A*027401*";
RL   Tissue Antigens 66(2):138-140(2005).
XX
RN   [2]
RP   1-1022
RA   Piancatelli D., Aureli A., Canossi A., Del Beato T., Papola F., Fioroni A.,
RA   Liberatore G., Mastrangelo E., Tessitore A., Adorno D.;
RT   ;
RL   Submitted (28-OCT-2004) to the INSDC.
RL   CNR- Istituto per i Trapianti d'Organo e l'Immunocitologia- Centro
RL   Regionale di Immunoematologia e Tipizzazione Tissutale, Piazzale
RL   Collemaggio, L'Aquila 67100, Italy
XX
DR   MD5; 2ef5e349788553e34dd6a56c5c1f9f87.
XX
CC   On or before Apr 5, 2016 this sequence version replaced
CC   gi:58414969, gi:58414970, gi:58414971, gi:58414968.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1022
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="F154"
FT                   /mol_type="genomic DNA"
FT                   /isolation_source="caucasoid individual; potential bone
FT                   marrow recipient"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1022
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02 variant"
FT   mRNA            join(<1..270,371..646,747..>1022)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,371..646,747..>1022)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q5EPE9"
FT                   /protein_id="AAW73085.1"
FT                   /translation="SHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGS
FT                   DWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTC
FT                   VEWLRRYLENRKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHVQHEGLPKPLTLRW"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02 variant"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02 variant"
FT                   /number=3
FT   variation       622
FT                   /gene="HLA-A"
FT                   /replace="g"
FT                   /note="compared with HLA-A*020101 allele"
FT   gap             647..746
FT                   /estimated_length=unknown
FT   exon            747..1022
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02 variant"
FT                   /number=4
XX
SQ   Sequence 1022 BP; 172 A; 244 C; 281 G; 125 T; 200 other;
     gctctcactc catgaggtat ttcttcacat ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggagggtccg gagtattggg       180
     acggggagac acggaaagtg aaggcccact cacagactca ccgagtggac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn gttctcacac cgtccagagg atgtatggct gcgacgtggg gtcggactgg       420
     cgcttcctcc gcgggtacca ccagtacgcc tacgacggca aggattacat cgccctgaaa       480
     gaggacctgc gctcttggac cgcggcggac atggcagctc agaccaccaa gcacaagtgg       540
     gaggcggccc atgtggcgga gcagttgaga gcctacctgg agggcacgtg cgtggagtgg       600
     ctccgcagat acctggagaa caggaaggag acgctgcagc gcacggnnnn nnnnnnnnnn       660
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       720
     nnnnnnnnnn nnnnnnnnnn nnnnnnacgc ccccaaaacg catatgactc accacgctgt       780
     ctctgaccat gaagccaccc tgaggtgctg ggccctgagc ttctaccctg cggagatcac       840
     actgacctgg cagcgggatg gggaggacca gacccaggac acggagctcg tggagaccag       900
     gcctgcaggg gatggaacct tccagaagtg ggcggctgtg gtggtgcctt ctggacagga       960
     gcagagatac acctgccatg tgcagcatga gggtttgccc aagcccctca ccctgagatg      1020
     gg                                                                     1022
//