Dbfetch

ID   AY786587; SV 1; linear; mRNA; STD; HUM; 1116 BP.
XX
AC   AY786587;
XX
DT   13-NOV-2004 (Rel. 81, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) mRNA, HLA-A*110101 allele,
DE   complete cds, alternatively spliced.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1116
RX   DOI; 10.1111/j.1399-0039.2006.00687.x.
RX   PUBMED; 17092262.
RA   Sun Y., Liu S., Luo Y., Liang F., Xi Y.;
RT   "Identification and frequency of a novel HLA-A allele, A*110104";
RL   Tissue Antigens 68(5):453-454(2006).
XX
RN   [2]
RP   1-1116
RA   Sun Y., Xi Y., Liu S., Luo Y., Liu J., Liang F., Liu N., Jin L., Xi C.,
RA   Guo S.;
RT   ;
RL   Submitted (19-OCT-2004) to the INSDC.
RL   Dept. of Immunology, Bei Taiping Lu Hospital, 2 Bei Taiping Lu, Beijing
RL   100039, China
XX
DR   MD5; a0d3b030c88544040cc39808b0cb0320.
DR   H-InvDB; HIT000257793_04.4.
DR   H-InvDB; HIT000257793_05.4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1116
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.31"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   gene            1..1116
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*110101"
FT   CDS             1..1116
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*110101"
FT                   /product="MHC class I antigen"
FT                   /note="includes 18 bp of intron 5 that may elongate
FT                   cytoplasmic domain; alternatively spliced"
FT                   /db_xref="GOA:P13746"
FT                   /db_xref="H-InvDB:HIT000257793_03.4"
FT                   /db_xref="HGNC:HGNC:4931"
FT                   /db_xref="IMGT/HLA:A*11:01:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR021157"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="InterPro:IPR037055"
FT                   /db_xref="PDB:1Q94"
FT                   /db_xref="PDB:1QVO"
FT                   /db_xref="PDB:1X7Q"
FT                   /db_xref="PDB:2HN7"
FT                   /db_xref="PDB:4MJ5"
FT                   /db_xref="PDB:4MJ6"
FT                   /db_xref="PDB:4N8V"
FT                   /db_xref="PDB:4UQ2"
FT                   /db_xref="PDB:5GRD"
FT                   /db_xref="PDB:5GRG"
FT                   /db_xref="PDB:5GSD"
FT                   /db_xref="UniProtKB/Swiss-Prot:P13746"
FT                   /protein_id="AAV53345.1"
FT                   /translation="MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFYTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGT
FT                   LRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMA
FT                   AQITKRKWEAAHAAEQQRAYLEGRCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWELSSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSGGE
FT                   GVKDRKGGSYTQAASSDSAQGSDVSLTACKV"
FT   variation       1013..1030
FT                   /gene="HLA-A"
FT                   /replace=""
FT                   /note="compared to GenBank Accession Number AY786585;
FT                   corresponds to portion of intron 5 retained in transcript"
XX
SQ   Sequence 1116 BP; 225 A; 332 C; 381 G; 178 T; 0 other;
     atggccgtca tggcgccccg aaccctcctc ctgctactct cgggggccct ggccctgacc        60
     cagacctggg cgggctccca ctccatgagg tatttctaca cctccgtgtc ccggcccggc       120
     cgcggggagc cccgcttcat cgccgtgggc tacgtggacg acacgcagtt cgtgcggttc       180
     gacagcgacg ccgcgagcca gaggatggag ccgcgggcgc cgtggataga gcaggagggg       240
     ccggagtatt gggaccagga gacacggaat gtgaaggccc agtcacagac tgaccgagtg       300
     gacctgggga ccctgcgcgg ctactacaac cagagcgagg acggttctca caccatccag       360
     ataatgtatg gctgcgacgt ggggccggac gggcgcttcc tccgcgggta ccggcaggac       420
     gcctacgacg gcaaggatta catcgccctg aacgaggacc tgcgctcttg gaccgcggcg       480
     gacatggcag ctcagatcac caagcgcaag tgggaggcgg cccatgcggc ggagcagcag       540
     agagcctacc tggagggccg gtgcgtggag tggctccgca gatacctgga gaacgggaag       600
     gagacgctgc agcgcacgga cccccccaag acacatatga cccaccaccc catctctgac       660
     catgaggcca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc       720
     tggcagcggg atggggagga ccagacccag gacacggagc tcgtggagac caggcctgca       780
     ggggatggaa ccttccagaa gtgggcggct gtggtggtgc cttctggaga ggagcagaga       840
     tacacctgcc atgtgcagca tgagggtctg cccaagcccc tcaccctgag atgggagctg       900
     tcttcccagc ccaccatccc catcgtgggc atcattgctg gcctggttct ccttggagct       960
     gtgatcactg gagctgtggt cgctgccgtg atgtggagga ggaagagctc aggtggagaa      1020
     ggggtgaaag atagaaaagg agggagttac actcaggctg caagcagtga cagtgcccag      1080
     ggctctgatg tgtctctcac agcttgtaaa gtgtga                                1116
//