Dbfetch

ID   AY772533; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AY772533;
XX
DT   01-NOV-2004 (Rel. 81, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*090102 variant
DE   allele, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RX   DOI; 10.1111/j.1399-0039.2006.00537.x.
RX   PUBMED; 16441501.
RA   Song C.H., Baek J.Y., Heo Y.S., Kwack K., Kwon O.J.;
RT   "Identification of a novel HLA-DRB1*09 allele, DRB1*0904, in the Korean
RT   population, by sequence-based typing";
RL   Tissue Antigens 67(2):179-180(2006).
XX
RN   [2]
RP   1-270
RA   Baek J.Y., Hur S.S., Lee M.N., Hong S.A., Kim Y.H., Kwon O.J.;
RT   "Human Leukocyte Antigen class II DRB1 New Allele DRB1*090102 Variant";
RL   Unpublished.
XX
RN   [3]
RP   1-270
RA   Baek J.Y., Hur S.S., Lee M.N., Hong S.A., Kim Y.H., Kwon O.J.;
RT   ;
RL   Submitted (06-OCT-2004) to the INSDC.
RL   Molecular Genetics, BioSewoom Institute of Bioscience & Biotechnology,
RL   Wooyoung Technocenter 1F, #273-15, Sungsu 2-ga 3-dong,, Sungdong-gu, Seoul
RL   133-831, Republic of Korea
XX
DR   MD5; c038c262a1d1097a0df60b70fc8d1bfa.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="DRB1*090102 variant"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="DRB1*090102 variant"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="DRB1*090102 variant"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q5U9D1"
FT                   /db_xref="IMGT/HLA:DRB1*09:04"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q5U9D1"
FT                   /protein_id="AAV38108.1"
FT                   /translation="RFLKQDKFECHFFNGTERVRYLHRGIYNQEENVRFDSDVGEYRAV
FT                   TELGRPVAESWNSQKDLLERRRAEVDTVCRHNYGVGESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="DRB1*090102 variant"
FT                   /number=2
XX
SQ   Sequence 270 BP; 60 A; 62 C; 102 G; 46 T; 0 other;
     cacgtttctt gaagcaggat aagtttgagt gtcatttctt caacgggacg gagcgggtgc        60
     ggtatctgca cagaggcatc tataaccaag aggagaacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgtcgc cgagtcctgg aacagccaga       180
     aggacctcct ggagcggagg cgggccgagg tggacaccgt gtgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagaggcgag                                        270
//