Dbfetch

ID   AY770514; SV 1; linear; mRNA; STD; HUM; 801 BP.
XX
AC   AY770514;
XX
DT   13-OCT-2004 (Rel. 81, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Homo sapiens MHC class II antigen (DRB1) mRNA, DRB1*07 allele, complete
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-801
RX   DOI; 10.1111/j.1399-0039.2005.00407.x.
RX   PUBMED; 15896200.
RA   Vilches C., Sepulveda S., Balas A., Solis R., Aviles M.J., Estefania E.,
RA   Gomez-Lozano N., Vicario J.L., DePablo R.;
RT   "Complete coding sequences and haplotypic associations of HLA-B*0707,
RT   -B*1524, -B*4405, -B*4802, -DRB1*0409, -DRB1*0411, -DRB1*1115, -DRB1*1305,
RT   and the novel allele -DRB1*0709. Group-specific amplification of cDNA from
RT   DRB1 alleles associated to DRB3 and DRB4";
RL   Tissue Antigens 65(6):529-538(2005).
XX
RN   [2]
RP   1-801
RA   Balas A., Garcia-Sanchez F., Vicario J.L.IV.;
RT   "Description of a new DRB1 allele";
RL   Unpublished.
XX
RN   [3]
RP   1-801
RA   Balas A., Garcia-Sanchez F., Vicario J.L.IV.;
RT   ;
RL   Submitted (04-OCT-2004) to the INSDC.
RL   Histocompatibility, Regional Transfusion Center of Madrid, Avda. De La
RL   Democracia, Madrid 28032, Spain
XX
DR   MD5; d74a6e5fd575481d9afaee6459ecfb55.
DR   H-InvDB; HIT000257672_03.4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..801
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   gene            1..801
FT                   /gene="DRB1"
FT                   /allele="DRB1*07"
FT   CDS             1..801
FT                   /codon_start=1
FT                   /gene="DRB1"
FT                   /allele="DRB1*07"
FT                   /product="MHC class II antigen"
FT                   /note="HLA-DRB1"
FT                   /db_xref="GOA:Q5XKU0"
FT                   /db_xref="H-InvDB:HIT000257672_02.4"
FT                   /db_xref="IMGT/HLA:DRB1*07:09"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XKU0"
FT                   /protein_id="AAV28303.1"
FT                   /translation="MVCLKLPGGSCMAALTVTLMVLSSPLALAGDTQPRFLWQGKYKCH
FT                   FFNGTERVQFLERFFYNQEEFVRFDSDVGEYRAVTELGRPVAESWNSQKDILEDRRGQV
FT                   DTVCRHNYGVGESFTVQRRVHPEVTVYPAKTQPLQHHNLLVCSVSGFYPGSIEVRWFRN
FT                   GQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVMSPLTVEWRARSE
FT                   SAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS"
XX
SQ   Sequence 801 BP; 170 A; 200 C; 262 G; 169 T; 0 other;
     atggtgtgtc tgaagctccc tggaggctcc tgcatggcag ctctgacagt gacactgatg        60
     gtgctgagct ccccactggc tttggctggg gacacccaac cacgtttcct gtggcagggt       120
     aagtataagt gtcatttctt caacgggacg gagcgggtgc agttcctgga aagattcttc       180
     tataaccagg aggagttcgt gcgcttcgac agcgacgtgg gggagtaccg ggcggtgacg       240
     gagctagggc ggcctgtcgc cgagtcctgg aacagccaga aggacatcct ggaggacagg       300
     cggggccagg tggacaccgt gtgcagacac aactacgggg ttggtgagag cttcacagtg       360
     cagcggcgag tccatcctga ggtgactgtg tatcctgcca agactcagcc cctgcagcac       420
     cacaacctcc tggtctgctc tgtgagtggt ttctatccag gcagcattga agtcaggtgg       480
     ttccggaacg gccaggaaga gaaggctggg gtggtgtcca caggcctgat ccagaatgga       540
     gactggacct tccagaccct ggtgatgctg gaaacagttc ctcggagtgg agaagtttac       600
     acctgccaag tggagcaccc aagtgtgatg agccctctca cagtggaatg gagagcacgg       660
     tctgaatctg cacagagcaa gatgctgagt ggagtcgggg gctttgtgct gggcctgctc       720
     ttccttgggg ccgggttgtt catctacttc aggaatcaga aaggacactc tggacttcag       780
     ccaacaggat tcctgagctg a                                                 801
//