Dbfetch

ID   AY769916; SV 1; linear; genomic DNA; STD; HUM; 2274 BP.
XX
AC   AY769916;
XX
DT   31-OCT-2004 (Rel. 81, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B-B*8102 allele, exons 1
DE   through 5 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2274
RA   Avergas C.U., Eller S.R., Iglehart B.S., Leffell M.S.;
RT   "HLA B*8102 Sequence: Promoter - Partial Exon 5";
RL   Unpublished.
XX
RN   [2]
RP   1-2274
RA   Avergas C.U., Eller S.R., Iglehart B.S., Leffell M.S.;
RT   ;
RL   Submitted (01-OCT-2004) to the INSDC.
RL   Medicine, Johns Hopkins University, 2041 E. Monument St, Baltimore, MD
RL   21205, USA
XX
DR   MD5; 9b7716d8657aa6b98d0ba63cb887cc28.
DR   EPD; EP73522; HS_HLA-B.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2274
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <303..>2274
FT                   /gene="HLA-B"
FT                   /allele="B*8102"
FT   mRNA            join(<303..375,504..773,1019..1294,1869..2144,2238..>2274)
FT                   /gene="HLA-B"
FT                   /allele="B*8102"
FT                   /product="MHC class I antigen"
FT   CDS             join(303..375,504..773,1019..1294,1869..2144,2238..>2274)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /allele="B*8102"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:B*81:02"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q5UAG1"
FT                   /protein_id="AAV36001.1"
FT                   /translation="MLVMAPRTVLLLLSAALALTETWAGSHSMRYFYTSVSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRN
FT                   LRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTA
FT                   AQISQRKLEAARVAEQLRAYLEGECVEWLRRYLENGKDKLERADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWTAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVG"
FT   exon            <303..375
FT                   /gene="HLA-B"
FT                   /allele="B*8102"
FT                   /number=1
FT   exon            504..773
FT                   /gene="HLA-B"
FT                   /allele="B*8102"
FT                   /number=2
FT   exon            1019..1294
FT                   /gene="HLA-B"
FT                   /allele="B*8102"
FT                   /number=3
FT   exon            1869..2144
FT                   /gene="HLA-B"
FT                   /allele="B*8102"
FT                   /number=4
FT   exon            2238..>2274
FT                   /gene="HLA-B"
FT                   /allele="B*8102"
FT                   /number=5
XX
SQ   Sequence 2274 BP; 428 A; 717 C; 718 G; 411 T; 0 other;
     ttggtgtagg agaagaggga tcaggacgaa gtcccaggtc ccggacgggg ctctcagggt        60
     ctcaggctcc gagggccgcg tctgcaatgg ggaggcgcag cgttggggat tccccactcc       120
     cctgagtttc acttcttctc ccaacttgtg tcgggtcctt cttccaggat actcgtgacg       180
     cgtccccact tcccactccc attgggtatt ggatatctag agaagccaat cagcgtcgcc       240
     gcggtcccag ttctaaagtc cccacgcacc cacccggact cagagtctcc tcagacgccg       300
     agatgctggt catggcgccc cgaaccgtcc tcctgctgct ctcggcggcc ctggccctga       360
     ccgagacctg ggccggtgag tgcgggtcgg gagggaaatg gcctctgccg ggaggagcga       420
     ggggaccgca ggcgggggcg caggacctga ggagccgcgc cgggaggagg gtcgggcggg       480
     tctcagcccc tcctcacccc caggctccca ctccatgagg tatttctaca cctccgtgtc       540
     ccggcccggc cgcggggagc cccgcttcat ctcagtgggc tacgtggacg acacccagtt       600
     cgtgaggttc gacagcgacg ccgcgagtcc gagagaggag ccgcgggcgc cgtggataga       660
     gcaggagggg ccggagtatt gggaccggaa cacacagatc tacaaggccc aggcacagac       720
     tgaccgagag agcctgcgga acctgcgcgg ctactacaac cagagcgagg ccggtgagtg       780
     accccggccc ggggcgcagg tcacgactcc ccatccccca cgtacggccc gggtcgcccc       840
     gagtctccgg gtccgagatc cgcctccctg aggccgcggg acccgcccag accctcgacc       900
     ggcgagagcc ccaggcgcgt ttacccggtt tcattttcag ttgaggccaa aatccccgcg       960
     ggttggtcgg ggcggggcgg ggctcggggg actgggctga ccgcggggcc ggggccaggg      1020
     tctcacaccc tccagagcat gtacggctgc gacgtggggc cggacgggcg cctcctccgc      1080
     gggcataacc agtacgccta cgacggcaag gattacatcg ccctgaacga ggacctgcgc      1140
     tcctggaccg ccgcggacac ggcggctcag atctcccagc gcaagttgga ggcggcccgt      1200
     gtggcggagc agctgagagc ctacctggag ggcgagtgcg tggagtggct ccgcagatac      1260
     ctggagaacg ggaaggacaa gctggagcgc gctggtacca ggggcagtgg ggagccttcc      1320
     ccatctccta taggtcgccg gggatggcct cccacgagaa gaggaggaaa atgggatcag      1380
     cgctagaatg tcgccctccg ttgaatggag aatggcatga gttttcctga gtttcctctg      1440
     agggccccct cttctctcta gacaattaag gaatgacgtc tctgaggaaa tggaggggaa      1500
     gacagtccct agaatactga tcaggggtcc cctttgaccc ctgcagcagc cttgggaacc      1560
     gtgacttttc ctctcaggcc ttgttctctg cctcacactc agtgtgtttg gggctctgat      1620
     tccagcactt ctgagtcact ttacctccac tcagatcagg agcagaagtc cctgttcccc      1680
     gctcagagac tcgaactttc caatgaatag gagattatcc caggtgcctg cgtccaggct      1740
     ggtgtctggg ttctgtgccc cttccccacc ccaggtgtcc tgtccattct caggctggtc      1800
     acatgggtgg tcctagggtg tcccatgaaa gatgcaaagc gcctgaattt tctgactctt      1860
     cccatcagac cccccaaaga cacacgtgac ccaccacccc atctctgacc atgaggccac      1920
     cctgaggtgc tgggccctgg gtttctaccc tgcggagatc acactgacct ggcagcggga      1980
     tggcgaggac caaactcagg acactgagct tgtggagacc agaccagcag gagatagaac      2040
     cttccagaag tggacagctg tggtggtgcc ttctggagaa gagcagagat acacatgcca      2100
     tgtacagcat gaggggctgc cgaagcccct caccctgaga tggggtaagg agggggatga      2160
     ggggtcatat ctcttctcag ggaaagcagg agcccttcag cagggtcagg gcccctcatc      2220
     ttcccctcct ttcccagagc cgtcttccca gtccaccgtc cccatcgtgg gcat            2274
//