Dbfetch

ID   AY766103; SV 2; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AY766103;
XX
DT   12-JAN-2005 (Rel. 82, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 3)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*04new allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Smith A.G., Regen L., Warnock S., Wohlwend G., Kim K., Shenavar Y.,
RA   de Guzman G., Hansen J.A.;
RT   "HLA-DR4 allele and haplotype diversity in a hematopoietic cell transplant
RT   population";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Smith A.G., Regen L., Wohlwend G.;
RT   ;
RL   Submitted (28-SEP-2004) to the INSDC.
RL   Clinical Immunogenetics Laboratory, Seattle Cancer Care Alliance, 825
RL   Eastlake Ave. E., Seattle, WA 98109, USA
XX
RN   [3]
RC   Sequence update by submitter
RP   1-270
RA   Smith A.G., Regen L., Wohlwend G.;
RT   ;
RL   Submitted (23-APR-2008) to the INSDC.
RL   Clinical Immunogenetics Laboratory, Seattle Cancer Care Alliance, 825
RL   Eastlake Ave. E., Seattle, WA 98109, USA
XX
DR   MD5; 06372d21b3b096508c490eb44359c5ba.
XX
CC   On Apr 23, 2008 this sequence version replaced gi:57231272.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*04new"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*04new"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*04new"
FT                   /product="MHC class II antigen"
FT                   /note="HLA-DR4 allele"
FT                   /db_xref="GOA:Q5ID26"
FT                   /db_xref="IMGT/HLA:DRB1*04:75"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ID26"
FT                   /protein_id="AAW47394.2"
FT                   /translation="RFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDLLEQTRAAVDTYCRHNYGVGESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*04new"
FT                   /number=2
FT   variation       199
FT                   /gene="HLA-DRB1"
FT                   /replace="g"
FT                   /note="compared to HLA-DRB1*0401"
XX
SQ   Sequence 270 BP; 59 A; 66 C; 97 G; 48 T; 0 other;
     cacgtttctt ggagcaggtt aaacatgagt gtcatttctt caacgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tatcaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacctcct ggagcagacg cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//