spacer

EBI Dbfetch

ID   AY762968; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AY762968;
XX
DT   01-FEB-2005 (Rel. 82, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens MHC class II antigen (HLA-DQB1) gene, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RX   DOI; 10.1111/j.1399-0039.2005.00397.x.
RX   PUBMED; 15853909.
RA   Gu H., Kimm K., Lee J.K., Oh B.;
RT   "Identification of a novel HLA-DQB1 allele, DQB1*0314, by sequence-based
RT   typing in the Korean population";
RL   Tissue Antigens 65(5):503-504(2005).
XX
RN   [2]
RP   1-270
RA   Lee J.-K., Gu H.;
RT   ;
RL   Submitted (24-SEP-2004) to the INSDC.
RL   National Genome Research Institute, 5 Nokbeon-dong, Eunpyeng-gu, Seoul
RL   122-701, Republic of Korea
XX
DR   MD5; 7b50832f14115fa99a883940bf55bcfd.
DR   Ensembl-Gn; ENSG00000225824; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231286; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233209; homo_sapiens.
DR   Ensembl-Tr; ENST00000399088; homo_sapiens.
DR   Ensembl-Tr; ENST00000413089; homo_sapiens.
DR   Ensembl-Tr; ENST00000416192; homo_sapiens.
DR   Ensembl-Tr; ENST00000419914; homo_sapiens.
DR   Ensembl-Tr; ENST00000422950; homo_sapiens.
DR   Ensembl-Tr; ENST00000424806; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DQB1"
FT   mRNA            <1..>270
FT                   /gene="HLA-DQB1"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DQB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:P01920"
FT                   /db_xref="HGNC:HGNC:4944"
FT                   /db_xref="IMGT/HLA:DQB1*03:14:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:1JK8"
FT                   /db_xref="PDB:1NBN"
FT                   /db_xref="PDB:1S9V"
FT                   /db_xref="PDB:1UVQ"
FT                   /db_xref="PDB:2NNA"
FT                   /db_xref="PDB:4GG6"
FT                   /db_xref="PDB:4OZF"
FT                   /db_xref="PDB:4OZG"
FT                   /db_xref="PDB:4OZH"
FT                   /db_xref="PDB:4OZI"
FT                   /db_xref="UniProtKB/Swiss-Prot:P01920"
FT                   /protein_id="AAV97949.1"
FT                   /translation="DFVYQFKAMCYFTNGTERVRYVTRYIYNREEYARFDSDVGVYRAV
FT                   TPLGPPAAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRR"
FT   exon            1..270
FT                   /gene="HLA-DQB1"
FT                   /number=2
XX
SQ   Sequence 270 BP; 60 A; 72 C; 93 G; 45 T; 0 other;
     aggatttcgt gtaccagttt aaggccatgt gctacttcac caacgggacg gagcgcgtgc        60
     gttatgtgac cagatacatc tataaccgag aggagtacgc acgcttcgac agcgacgtgg       120
     gggtgtaccg ggcggtgacg ccgctggggc cgcctgccgc cgagtactgg aacagccaga       180
     aggaagtcct ggagaggacc cgggcggagt tggacacggt gtgcagacac aactaccagt       240
     tggagctccg cacgaccttg cagcggcgag                                        270
//


spacer
spacer