Dbfetch

ID   AY750899; SV 1; linear; genomic DNA; STD; HUM; 465 BP.
XX
AC   AY750899;
XX
DT   01-JAN-2005 (Rel. 82, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 8)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*111902 allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-465
RX   DOI; 10.1111/j.1399-0039.2005.00404.x.
RX   PUBMED; 15982264.
RA   Li D., Gao H.F., Liu X., Jiang D., Li Z., Liu Y.H., Jiang Y.Z., Li L.,
RA   Lan G.X., Zhao C.Z., Guo T., Cai B., Wang D., Sun G.Y., Zhang D., Lu D.P.;
RT   "Identification of a novel HLA-DRB1 allele (HLA-DRB1*111902*)";
RL   Tissue Antigens 66(1):67-68(2005).
XX
RN   [2]
RP   1-465
RA   Gao H.F., Liu X., Jiang D., Li Z., Liu Y.H., Jiang Y.Z., Li L., Lan G.X.,
RA   Zhao C.Z., Guo T., Cai C., Wang D., Li L., Sun G.Y.;
RT   ;
RL   Submitted (14-SEP-2004) to the INSDC.
RL   HLA Typing Group, CapitalBio Corporation, National Engineering Research
RL   Center For Beijing Biochip Technology, 18 Life Science Parkway, Changping
RL   District, Beijing 102206, China
XX
RN   [3]
RP   1-465
RA   Li D., Lu D.P.;
RT   ;
RL   Submitted (14-SEP-2004) to the INSDC.
RL   HLA Typing Lab, Peking University People's Hospital, 11 Xizhimen South
RL   Street, Haidian District, Beijing 100044, China
XX
DR   MD5; 9d1821602a92190c8219be34685a72fc.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..465
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6q21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>465
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*111902"
FT   mRNA            <136..>405
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*111902"
FT                   /product="MHC class II antigen"
FT   CDS             <136..>405
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*111902"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q5IFG9"
FT                   /db_xref="IMGT/HLA:DRB1*11:19:02"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q5IFG9"
FT                   /protein_id="AAV38129.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEFRAV
FT                   TELGRPDEEYWNSQKDILEDRRAAVDTYCRHNYGVGESFTVQRR"
FT   exon            136..405
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*111902"
FT                   /number=2
XX
SQ   Sequence 465 BP; 80 A; 117 C; 176 G; 92 T; 0 other;
     tggtgggcgt tgcggcgggg gccggttaag gttcccagtg cccgcacccg gcccagggag        60
     ccccggatgg cggcgtcact gtcagtgtct tctcaggagg ccgcctgtgt gactggatcg       120
     ttcgtgtccc cacagcacgt ttcttggagt actctacgtc tgagtgtcat ttcttcaatg       180
     ggacggagcg ggtgcggttc ctggacagat acttctataa ccaagaggag tacgtgcgct       240
     tcgacagcga cgtgggggag ttccgggcgg tgacggagct ggggcggcct gatgaggagt       300
     actggaacag ccagaaggac atcctggaag acaggcgcgc cgcggtggac acctactgca       360
     gacacaacta cggggttggt gagagcttca cagtgcagcg gcgaggtgag cgcggcgcgg       420
     ggcggggcct gagtccctgt gagctgggaa tctgagtgtg tgtgt                       465
//