spacer

EBI Dbfetch

ID   AH014149; SV 2; linear; genomic DNA; STD; HUM; 1269 BP.
XX
AC   AH014149; AY748458-AY748461;
XX
DT   31-JUL-2011 (Rel. 109, Created)
DT   31-JUL-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I related protein A (MICA) gene, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1269
RA   Mas V., Amezaga N., Arostegui J.I., Masso M., Plaza S., Rius F.,
RA   Ercilla G., Vives J., Yague J.;
RT   "Description of a new MICA allele";
RL   Unpublished.
XX
RN   [2]
RP   1-1269
RA   Mas V., Amezaga N., Arostegui J.I., Masso M., Plaza S., Rius F.,
RA   Ercilla G., Vives J., Yague J.;
RT   ;
RL   Submitted (13-SEP-2004) to the INSDC.
RL   Immunology, Hospital Clinic, Villarroel 170, Barcelona, Catalonia 08036,
RL   Spain
XX
DR   Ensembl-Gn; ENSG00000183214; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235233; homo_sapiens.
DR   Ensembl-Tr; ENST00000400325; homo_sapiens.
DR   Ensembl-Tr; ENST00000418465; homo_sapiens.
DR   Ensembl-Tr; ENST00000547609; homo_sapiens.
DR   IMGT/LIGM; AH014149.
XX
CC   On or before Jul 29, 2011 this sequence version replaced
CC   gi:53831050, gi:53831051, gi:53831052, gi:53831053, gi:53831049.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1269
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1269
FT                   /gene="MICA"
FT   mRNA            join(<1..255,356..643,744..1022,1123..>1269)
FT                   /gene="MICA"
FT                   /product="MHC class I related protein A"
FT   CDS             join(<1..255,356..643,744..1022,1123..>1269)
FT                   /codon_start=3
FT                   /gene="MICA"
FT                   /product="MHC class I related protein A"
FT                   /note="may play a role in the activation of a subpopulation
FT                   of NK cells that express the NKG2D receptor; similar to
FT                   MICA*00201"
FT                   /db_xref="GOA:Q29983"
FT                   /db_xref="HGNC:HGNC:7090"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="PDB:1B3J"
FT                   /db_xref="PDB:1HYR"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q29983"
FT                   /protein_id="AAU95382.1"
FT                   /translation="PHSLRYNLTVLSGDGSVQSGFLAEVHLDGQPFLRCDRQKCRAKPQ
FT                   GQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTR
FT                   SSQHFYYDGELFLSQNLETEEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADC
FT                   LQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSL
FT                   SHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQS
FT                   HWQTFHVSAVAAAAAAAAAIFVIIIFYICCCKKKTSAAEGP"
FT   exon            <1..255
FT                   /gene="MICA"
FT                   /number=2
FT   gap             256..355
FT                   /estimated_length=unknown
FT   exon            356..643
FT                   /gene="MICA"
FT                   /number=3
FT   gap             644..743
FT                   /estimated_length=unknown
FT   exon            744..1022
FT                   /gene="MICA"
FT                   /number=4
FT   gap             1023..1122
FT                   /estimated_length=unknown
FT   exon            1123..>1269
FT                   /gene="MICA"
FT                   /number=5
XX
SQ   Sequence 1269 BP; 243 A; 246 C; 272 G; 208 T; 300 other;
     agccccacag tcttcgttat aacctcacgg tgctgtccgg ggatggatct gtgcagtcag        60
     ggtttctcgc tgaggtacat ctggatggtc agcccttcct gcgctgtgac aggcagaaat       120
     gcagggcaaa gccccaggga cagtgggcag aagatgtcct gggaaataag acatgggaca       180
     gagagaccag ggacttgaca gggaacggaa aggacctcag gatgaccctg gctcatatca       240
     aggaccagaa agaagnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnngcttg       360
     cattccctcc aggagattag ggtctgtgag atccatgaag acaacagcac caggagctcc       420
     cagcatttct actacgatgg ggagctcttc ctctcccaaa acctggagac tgaggaatgg       480
     acaatgcccc agtcctccag agctcagacc ttggccatga acgtcaggaa tttcttgaag       540
     gaagatgcca tgaagaccaa gacacactat cacgctatgc atgcagactg cctgcaggaa       600
     ctacggcgat atctaaaatc cggcgtagtc ctgaggagaa cagnnnnnnn nnnnnnnnnn       660
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       720
     nnnnnnnnnn nnnnnnnnnn nnntgccccc catggtgaat gtcacccgca gcgaggcctc       780
     agagggcaac attaccgtga catgcagggc ttctggcttc tatccctgga atatcacact       840
     gagctggcgt caggatgggg tatctttgag ccacgacacc cagcagtggg gggatgtcct       900
     gcctgatggg aatggaacct accagacctg ggtggccacc aggatttgcc aaggagagga       960
     gcagaggttc acctgctaca tggaacacag cgggaatcac agcactcacc ctgtgccctc      1020
     tgnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1080
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnggaaagtg ctggtgcttc      1140
     agagtcattg gcagacattc catgtttctg ctgttgctgc tgctgctgct gctgctgctg      1200
     ctatttttgt tattattatt ttctacatct gttgttgtaa gaagaaaaca tcagctgcag      1260
     agggtccag                                                              1269
//


spacer
spacer