Dbfetch

ID   AY724685; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AY724685;
XX
DT   10-MAY-2005 (Rel. 83, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*090103 allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RX   DOI; 10.1111/j.1399-0039.2005.00372.x.
RX   PUBMED; 15730527.
RA   Hu Z., Liu Z., Xiong Y., Lv F., Fu Y., Lin J., Xu A.;
RT   "A novel HLA-DRB1*09 allele, HLA-DRB1*090103*, isolated from the Han
RT   population of Guangdong, China";
RL   Tissue Antigens 65(3):293-294(2005).
XX
RN   [2]
RP   1-270
RA   Hu Z., Liu Z., Xiong Y., Fu Y., Lin J., Zhu Q., Xu A.;
RT   ;
RL   Submitted (13-AUG-2004) to the INSDC.
RL   Department of Biochemistry, Sun Yat-Sen University, Guangzhou, Guangdong
RL   510275, P.R.China
XX
DR   MD5; b0fd730e7ec8af5842793ac372f04aeb.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="peripheral blood leukocyte"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="DRB1*090103"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="DRB1*090103"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="DRB1*090103"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q50EW5"
FT                   /db_xref="IMGT/HLA:DRB1*09:01:03"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q50EW5"
FT                   /protein_id="AAW59561.1"
FT                   /translation="RFLKQDKFECHFFNGTERVRYLHRGIYNQEENVRFDSDVGEYRAV
FT                   TELGRPVAESWNSQKDFLERRRAEVDTVCRHNYGVGESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="DRB1*090103"
FT                   /number=2
XX
SQ   Sequence 270 BP; 60 A; 62 C; 101 G; 47 T; 0 other;
     cacgtttctt gaagcaggat aagtttgagt gtcatttctt caacgggacc gagcgggtgc        60
     ggtatctgca cagaggcatc tataaccaag aggagaacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgtcgc cgagtcctgg aacagccaga       180
     aggacttcct ggagcggagg cgggccgagg tggacaccgt gtgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagaggcgag                                        270
//