spacer

EBI Dbfetch

ID   AY714542; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AY714542;
XX
DT   02-MAR-2005 (Rel. 83, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*15 new allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Hu Z.H., Liu Z.H., Xiong Y.J., Zhu Q.Y., Fu Y.G., Liu Y.L., Xu A.L.;
RT   "A novel HLA-DRB1*15 allelic sequence isolated from the Han population of
RT   Guangdong, China";
RL   Eur. J. Immunogenet. 32(4):221-222(2005).
XX
RN   [2]
RP   1-270
RA   Hu Z., Liu Z., Xiong Y., Lin J., Fu Y., Lv F., Xu A.;
RT   ;
RL   Submitted (11-AUG-2004) to the INSDC.
RL   Department of Biochemistry, Sun Yat-Sen University, Guangzhou, Guangdong
RL   510275, P.R. China
XX
DR   MD5; 5fb3436206c864733c88dcf42f1c1f19.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="peripheral blood leukocyte"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*15 new"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*15 new"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*15 new"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q5DKQ6"
FT                   /db_xref="IMGT/HLA:DRB1*15:16"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q5DKQ6"
FT                   /protein_id="AAW57989.1"
FT                   /translation="RFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVREFRAV
FT                   TELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVVESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*15 new"
FT                   /number=2
XX
SQ   Sequence 270 BP; 56 A; 66 C; 100 G; 48 T; 0 other;
     cacgtttcct gtggcagcct aagagggagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccagg aggagtccgt gcgcttcgac agcgacgtga       120
     gggagttccg ggcggtgacg gagctggggc ggcctgacgc tgagtactgg aacagccaga       180
     aggacatcct ggagcaggcg cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer