Dbfetch

ID   AY705914; SV 1; linear; genomic DNA; STD; HUM; 879 BP.
XX
AC   AY705914;
XX
DT   25-SEP-2004 (Rel. 81, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*B5301V allele, exons
DE   2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-879
RA   Chu C.-C., Lin M.;
RT   "A novel HLA-B allele, B5301V";
RL   Unpublished.
XX
RN   [2]
RP   1-879
RA   Chu C.-C., Lin M.;
RT   ;
RL   Submitted (05-AUG-2004) to the INSDC.
RL   Department of Medical Research, Mackay Memorial Hospital, 92, Sec 2,
RL   Chung-Shan N Rd., Taipei, Taiwan
XX
DR   MD5; 2bee72d5595667ff045ca50f4e8aab30.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..879
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>879
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*B5301V"
FT   mRNA            join(<54..323,569..>844)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*B5301V"
FT   CDS             join(<54..323,569..>844)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*B5301V"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:B*53:01:03"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:Q5Y2E5"
FT                   /protein_id="AAU43594.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTE
FT                   PRAPWIEQEGPEYWDRNTQIFKTNTQTYRENLRIALRYYNQSEAGSHIIQRMYGCDLGP
FT                   DGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            54..323
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*B5301V"
FT                   /number=2
FT   exon            569..844
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*B5301V"
FT                   /number=3
XX
SQ   Sequence 879 BP; 152 A; 298 C; 311 G; 118 T; 0 other;
     ggagccgcgc cgggaggagg gtcgggcggg tctcagcccc tcctcgcccc caggctccca        60
     ctccatgagg tatttctaca ccgccatgtc ccggcccggc cgcggggagc cccgcttcat       120
     cgcagtgggc tacgtggacg acacccagtt cgtgaggttc gacagcgacg ccgcgagtcc       180
     gaggacggag ccccgggcgc catggataga gcaggagggg ccggagtatt gggaccggaa       240
     cacacagatc ttcaagacca acacacagac ttaccgagag aacctgcgga tcgcgctccg       300
     ctactacaac cagagcgagg ccggtgagtg accccggccc ggggcgcagg tcacgactcc       360
     ccatccccca cgtacggccc gggtcgcccc gagtctccgg gtccgagatc cgcctccctg       420
     aggccgcggg acccgcccag accctcgacc ggcgagagcc ccaggcgcgt ttacccggtt       480
     tcattttcag ttgaggccaa aatccccgcg ggttggtcgg ggcggggcgg ggctcggggg       540
     acggggctga ccgcggggcc ggggccaggg tctcacatca tccagaggat gtatggctgc       600
     gacctggggc ccgacgggcg cctcctccgc gggcatgacc agtccgccta cgacggcaag       660
     gattacatcg ccctgaacga ggacctgagc tcctggaccg cggcggacac ggcggctcag       720
     atcacccagc gcaagtggga ggcggcccgt gtggcggagc agctgagagc ctacctggag       780
     ggcctgtgcg tggagtggct ccgcagatac ctggagaacg ggaaggagac gctgcagcgc       840
     gcgggtacca ggggcagtgg ggagccttcc ccatctcct                              879
//