spacer

EBI Dbfetch

ID   AY686615; SV 1; linear; genomic DNA; STD; HUM; 2162 BP.
XX
AC   AY686615;
XX
DT   24-AUG-2004 (Rel. 80, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens isolate 41698S MHC class I antigen precursor (HLA-B) gene,
DE   HLA-B*4812 allele, exons 1 through 5 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2162
RA   Robbins F.-M., Adams S., Chen D., Davey R., Marincola F.;
RT   "Identification of novel HLA class I alleles by direct sequencing of
RT   SSp-PCR products";
RL   Unpublished.
XX
RN   [2]
RP   1-2162
RA   Robbins F.-M., Adams S., Chen D., Davey R., Marincola F.;
RT   ;
RL   Submitted (15-JUL-2004) to the INSDC.
RL   Transfusion Medicine, National Institutes of Health, 9000 Rockville Pike,
RL   Bethesda, MD 20892, USA
XX
DR   MD5; 5e4549b285b9b1a049fe8d9809953ec3.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2162
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /isolate="41698S"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="peripheral blood"
FT                   /note="type: genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>2162
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4812"
FT   mRNA            join(<1..90,219..488,734..1009,1584..1859,1953..>2069)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4812"
FT                   /product="MHC class I antigen precursor"
FT   exon            <1..90
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4812"
FT                   /number=1
FT   CDS             join(18..90,219..488,734..1009,1584..1859,1953..>2069)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4812"
FT                   /product="MHC class I antigen precursor"
FT                   /note="antigen presenting molecule"
FT                   /db_xref="GOA:Q68J66"
FT                   /db_xref="IMGT/HLA:B*48:12"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q68J66"
FT                   /protein_id="AAT99915.1"
FT                   /translation="MLVMAPRTVLLLLSAALALTETWAGSHSMRYFYTSVSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRETQISKTNTQTYRESLRN
FT                   LRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQLRAYLEGECVEWLRRYLENGKDKLERADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWTAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSS"
FT   sig_peptide     18..89
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4812"
FT   exon            219..488
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4812"
FT                   /number=2
FT   exon            734..1009
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4812"
FT                   /number=3
FT   exon            1584..1859
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4812"
FT                   /number=4
FT   exon            1953..2069
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4812"
FT                   /number=5
XX
SQ   Sequence 2162 BP; 404 A; 657 C; 703 G; 398 T; 0 other;
     tctcctcaga cgccgagatg ctggtcatgg cgccccgaac cgtcctcctg ctgctctcgg        60
     cggccctggc cctgaccgag acctgggccg gtgagtgcgg gtcgggaggg aaatggcctc       120
     tgccgggagg agcgagggga ccgcaggcgg gggcgcagga cctgaggagc cgcgccggga       180
     ggagggtcgg gcgggtctca gcccctcctc acccccaggc tcccactcca tgaggtattt       240
     ctacacctcc gtgtcccggc ccggccgcgg ggagccccgc ttcatctcag tgggctacgt       300
     ggacgacacc cagttcgtga ggttcgacag cgacgccgcg agtccgagag aggagccgcg       360
     ggcgccgtgg atagagcagg aggggccgga gtattgggac cgggagacac agatctccaa       420
     gaccaacaca cagacttacc gagagagcct gcggaacctg cgcggctact acaaccagag       480
     cgaggccggt gagtgacccc ggcccggggc gcaggtcacg actccccatc ccccacgtac       540
     ggcccgggtc gccccgagtc tccgggtccg agatccgcct ccctgaggcc gcgggacccg       600
     cccagaccct cgaccggcga gagccccagg cgcgtttacc cggtttcatt ttcagttgag       660
     gccaaaatcc ccgcgggttg gtcggggcgg ggcggggctc gggggactgg gctgaccgcg       720
     gggccggggc cagggtctca caccctccag agcatgtacg gctgcgacgt ggggccggac       780
     gggcgcctcc tccgcgggca taaccagtac gcctacgacg gcaaggatta catcgccctg       840
     aacgaggacc tgagctcctg gaccgcggcg gacaccgcgg ctcagatcac ccagcgcaag       900
     tgggaggcgg cccgtgtggc ggagcagctg agagcctacc tggagggcga gtgcgtggag       960
     tggctccgca gatacctgga gaacgggaag gacaagctgg agcgcgctgg taccaggggc      1020
     agtggggagc cttccccatc tcctataggt cgccggggat ggcctcccac gagaagagga      1080
     ggaaaatggg atcagcgcta gaatgtcgcc ctccgttgaa tggagaatgg catgagtttt      1140
     cctgagtttc ctctgagggc cccctcttct ctctagacaa ttaaggaatg acgtctctga      1200
     ggaaatggag gggaagacag tccctagaat actgatcagg ggtccccttt gacccctgca      1260
     gcagccttgg gaaccgtgac ttttcctctc aggccttgtt ctctgcctca cactcagtgt      1320
     gtttggggct ctgattccag cacttctgag tcactttacc tccactcaga tcaggagcag      1380
     aagtccctgt tccccgctca gagactcgaa ctttccaatg aataggagat tatcccaggt      1440
     gcctgcgtcc aggctggtgt ctgggttctg tgccccttcc ccaccccagg tgtcctgtcc      1500
     attctcaggc tggtcacatg ggtggtccta gggtgtccca tgaaagatgc aaagcgcctg      1560
     aattttctga ctcttcccat cagacccccc aaagacacac gtgacccacc accccatctc      1620
     tgaccatgag gccaccctga ggtgctgggc cctgggtttc taccctgcgg agatcacact      1680
     gacctggcag cgggatggcg aggaccaaac tcaggacact gagcttgtgg agaccagacc      1740
     agcaggagat agaaccttcc agaagtggac agctgtggtg gtgccttctg gagaagagca      1800
     gagatacaca tgccatgtac agcatgaggg gctgccgaag cccctcaccc tgagatgggg      1860
     taaggagggg gatgaggggt catatctctt ctcagggaaa gcaggagccc ttcagcaggg      1920
     tcagggcccc tcatcttccc ctcctttccc agagccgtct tcccagtcca ccgtccccat      1980
     cgtgggcatt gttgctggcc tggctgtcct agcagttgtg gtcatcggag ctgtggtcgc      2040
     tgctgtgatg tgtaggagga agagttcagg tagggaaggg gtgaggggtg gggtctgggt      2100
     tttcttgtcc cactgggggt ttcaagcccc aggtagaagt gttccctgcc tcattactgg      2160
     ga                                                                     2162
//


spacer
spacer