spacer

EBI Dbfetch

ID   AY686614; SV 1; linear; genomic DNA; STD; HUM; 2235 BP.
XX
AC   AY686614;
XX
DT   24-AUG-2004 (Rel. 80, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens isolate 41697S MHC class I antigen precursor (HLA-B) gene,
DE   HLA-B*4812 allele, exons 1 through 5 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2235
RA   Robbins F.-M., Adams S., Chen D., Davey R., Marincola F.;
RT   "Identification of novel HLA class I alleles by direct sequencing of
RT   SSp-PCR products";
RL   Unpublished.
XX
RN   [2]
RP   1-2235
RA   Robbins F.-M., Adams S., Chen D., Davey R., Marincola F.;
RT   ;
RL   Submitted (15-JUL-2004) to the INSDC.
RL   Transfusion Medicine, National Institutes of Health, 9000 Rockville Pike,
RL   Bethesda, MD 20892, USA
XX
DR   MD5; 3d57b5735177e6b6ed84ffb38dd18f2a.
DR   EPD; EP73522; HS_HLA-B.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2235
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /isolate="41697S"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="peripheral blood"
FT                   /note="type: genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>2235
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4812"
FT   mRNA            join(<1..160,289..558,804..1079,1654..1929,2023..>2139)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4812"
FT                   /product="MHC class I antigen precursor"
FT   exon            <1..160
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4812"
FT                   /number=1
FT   CDS             join(88..160,289..558,804..1079,1654..1929,2023..>2139)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4812"
FT                   /product="MHC class I antigen precursor"
FT                   /note="antigen presenting molecule"
FT                   /db_xref="GOA:Q68J67"
FT                   /db_xref="IMGT/HLA:B*48:12"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q68J67"
FT                   /protein_id="AAT99914.1"
FT                   /translation="MLVMAPRTVLLLLSAALALTETWAGSHSMRYFYTSVSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRETQISKTNTQTYRESLRN
FT                   LRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQLRAYLEGECVEWLRRYLENGKDKLERADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWTAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSS"
FT   sig_peptide     88..159
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4812"
FT   exon            289..558
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4812"
FT                   /number=2
FT   exon            804..1079
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4812"
FT                   /number=3
FT   exon            1654..1929
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4812"
FT                   /number=4
FT   exon            2023..2139
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4812"
FT                   /number=5
XX
SQ   Sequence 2235 BP; 422 A; 685 C; 720 G; 408 T; 0 other;
     tctagagaag ccaatcagcg tcgccgcggt cccagttcta aagtccccac gcacccaccc        60
     ggactcagag tctcctcaga cgccgagatg ctggtcatgg cgccccgaac cgtcctcctg       120
     ctgctctcgg cggccctggc cctgaccgag acctgggccg gtgagtgcgg gtcgggaggg       180
     aaatggcctc tgccgggagg agcgagggga ccgcaggcgg gggcgcagga cctgaggagc       240
     cgcgccggga ggagggtcgg gcgggtctca gcccctcctc acccccaggc tcccactcca       300
     tgaggtattt ctacacctcc gtgtcccggc ccggccgcgg ggagccccgc ttcatctcag       360
     tgggctacgt ggacgacacc cagttcgtga ggttcgacag cgacgccgcg agtccgagag       420
     aggagccgcg ggcgccgtgg atagagcagg aggggccgga gtattgggac cgggagacac       480
     agatctccaa gaccaacaca cagacttacc gagagagcct gcggaacctg cgcggctact       540
     acaaccagag cgaggccggt gagtgacccc ggcccggggc gcaggtcacg actccccatc       600
     ccccacgtac ggcccgggtc gccccgagtc tccgggtccg agatccgcct ccctgaggcc       660
     gcgggacccg cccagaccct cgaccggcga gagccccagg cgcgtttacc cggtttcatt       720
     ttcagttgag gccaaaatcc ccgcgggttg gtcggggcgg ggcggggctc gggggactgg       780
     gctgaccgcg gggccggggc cagggtctca caccctccag agcatgtacg gctgcgacgt       840
     ggggccggac gggcgcctcc tccgcgggca taaccagtac gcctacgacg gcaaggatta       900
     catcgccctg aacgaggacc tgagctcctg gaccgcggcg gacaccgcgg ctcagatcac       960
     ccagcgcaag tgggaggcgg cccgtgtggc ggagcagctg agagcctacc tggagggcga      1020
     gtgcgtggag tggctccgca gatacctgga gaacgggaag gacaagctgg agcgcgctgg      1080
     taccaggggc agtggggagc cttccccatc tcctataggt cgccggggat ggcctcccac      1140
     gagaagagga ggaaaatggg atcagcgcta gaatgtcgcc ctccgttgaa tggagaatgg      1200
     catgagtttt cctgagtttc ctctgagggc cccctcttct ctctagacaa ttaaggaatg      1260
     acgtctctga ggaaatggag gggaagacag tccctagaat actgatcagg ggtccccttt      1320
     gacccctgca gcagccttgg gaaccgtgac ttttcctctc aggccttgtt ctctgcctca      1380
     cactcagtgt gtttggggct ctgattccag cacttctgag tcactttacc tccactcaga      1440
     tcaggagcag aagtccctgt tccccgctca gagactcgaa ctttccaatg aataggagat      1500
     tatcccaggt gcctgcgtcc aggctggtgt ctgggttctg tgccccttcc ccaccccagg      1560
     tgtcctgtcc attctcaggc tggtcacatg ggtggtccta gggtgtccca tgaaagatgc      1620
     aaagcgcctg aattttctga ctcttcccat cagacccccc aaagacacac gtgacccacc      1680
     accccatctc tgaccatgag gccaccctga ggtgctgggc cctgggtttc taccctgcgg      1740
     agatcacact gacctggcag cgggatggcg aggaccaaac tcaggacact gagcttgtgg      1800
     agaccagacc agcaggagat agaaccttcc agaagtggac agctgtggtg gtgccttctg      1860
     gagaagagca gagatacaca tgccatgtac agcatgaggg gctgccgaag cccctcaccc      1920
     tgagatgggg taaggagggg gatgaggggt catatctctt ctcagggaaa gcaggagccc      1980
     ttcagcaggg tcagggcccc tcatcttccc ctcctttccc agagccgtct tcccagtcca      2040
     ccgtccccat cgtgggcatt gttgctggcc tggctgtcct agcagttgtg gtcatcggag      2100
     ctgtggtcgc tgctgtgatg tgtaggagga agagttcagg tagggaaggg gtgaggggtg      2160
     gggtctgggt tttcttgtcc cactgggggt ttcaagcccc aggtagaagt gttccctgcc      2220
     tcattactgg gaagc                                                       2235
//


spacer
spacer