Dbfetch

ID   AY686613; SV 1; linear; genomic DNA; STD; HUM; 2162 BP.
XX
AC   AY686613;
XX
DT   24-AUG-2004 (Rel. 80, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens isolate 40390S MHC class I antigen precursor (HLA-B) gene,
DE   HLA-B*4813 allele, exons 1 through 5 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2162
RA   Robbins F.-M., Adams S., Chen D., Davey R., Marincola F.;
RT   "Identification of novel HLA class I alleles by direct sequencing of
RT   SSp-PCR products";
RL   Unpublished.
XX
RN   [2]
RP   1-2162
RA   Robbins F.-M., Adams S., Chen D., Davey R., Marincola F.;
RT   ;
RL   Submitted (15-JUL-2004) to the INSDC.
RL   Transfusion Medicine, National Institutes of Health, 9000 Rockville Pike,
RL   Bethesda, MD 20892, USA
XX
DR   MD5; a8290dd39e3cbd26490375d97db59d32.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2162
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /isolate="40390S"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="peripheral blood"
FT                   /note="type: genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>2162
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4813"
FT   mRNA            join(<1..90,219..488,733..1008,1584..1859,1953..>2069)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4813"
FT                   /product="MHC class I antigen precursor"
FT   exon            <1..90
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4813"
FT                   /number=1
FT   CDS             join(18..90,219..488,733..1008,1584..1859,1953..>2069)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4813"
FT                   /product="MHC class I antigen precursor"
FT                   /note="antigen presenting molecule"
FT                   /db_xref="GOA:Q68J68"
FT                   /db_xref="IMGT/HLA:B*48:13"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q68J68"
FT                   /protein_id="AAT99913.1"
FT                   /translation="MLVMAPRTVLLLLSAALALTETWAGSHSMRYFYTSVSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRETQISKTNTQTYRESLRN
FT                   LRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAARVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSS"
FT   sig_peptide     18..89
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4813"
FT   exon            219..488
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4813"
FT                   /number=2
FT   exon            733..1008
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4813"
FT                   /number=3
FT   exon            1584..1859
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4813"
FT                   /number=4
FT   exon            1953..2069
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4813"
FT                   /number=5
XX
SQ   Sequence 2162 BP; 400 A; 660 C; 709 G; 393 T; 0 other;
     tctcctcaga cgccgagatg ctggtcatgg cgccccgaac cgtcctcctg ctgctctcgg        60
     cggccctggc cctgaccgag acctgggccg gtgagtgcgg gtcgggaggg aaatggcctc       120
     tgccgggagg agcgagggga ccgcaggcgg gggcgcagga cctgaggagc cgcgccggga       180
     ggagggtcgg gcgggtctca gcccctcctc acccccaggc tcccactcca tgaggtattt       240
     ctacacctcc gtgtcccggc ccggccgcgg ggagccccgc ttcatctcag tgggctacgt       300
     ggacgacacc cagttcgtga ggttcgacag cgacgccgcg agtccgagag aggagccgcg       360
     ggcgccgtgg atagagcagg aggggccgga gtattgggac cgggagacac agatctccaa       420
     gaccaacaca cagacttacc gagagagcct gcggaacctg cgcggctact acaaccagag       480
     cgaggccggt gagtgacccc ggcccggggc gcaggtcacg actccccatc ccccacgtac       540
     ggcccgggtc gccccgagtc tccgggtccg agatccgccc ccgaggccgc gggacccgcc       600
     cagaccctcg accggcgaga gccccaggcg cgtttacccg gtttcatttt cagttgaggc       660
     caaaatcccc gcgggttggt cggggcgggg cggggctcgg ggggacgggg ctgaccgcgg       720
     gggcggggcc agggtctcac accctccaga gcatgtacgg ctgcgacgtg gggccggacg       780
     ggcgcctcct ccgcgggcat aaccagtacg cctacgacgg caaggattac atcgccctga       840
     acgaggacct gcgctcctgg accgccgcgg acacggcggc tcagatcacc cagcgcaagt       900
     gggaggcggc ccgtgtggcg gagcagctga gagcctacct ggagggcgag tgcgtggagt       960
     ggctccgcag atacctggag aacgggaagg agacgctgca gcgcgcgggt accaggggca      1020
     gtggggagcc ttccccatct cctataggtc gccggggatg gcctcccacg agaagaggag      1080
     gaaaatggga tcagcgctag aatgtcgccc tcccttgaat ggagaatggc atgagttttc      1140
     ctgagtttcc tctgagggcc ccctcttctc tctaggacaa ttaagggatg acgtctctga      1200
     ggaaatggag gggaagacag tccctagaat actgatcagg ggtccccttt gacccctgca      1260
     gcagccttgg gaaccgtgac ttttcctctc aggccttgtt ctctgcctca cactcagtgt      1320
     gtttggggct ctgattccag cacttctgag tcactttacc tccactcaga tcaggagcag      1380
     aagtccctgt tccccgctca gagactcgaa ctttccaatg aataggagat tatcccaggt      1440
     gcctgcgtcc aggctggtgt ctgggttctg tgccccttcc ccaccccagg tgtcctgtcc      1500
     attctcaggc tggtcacatg ggtggtccta gggtgtccca tgagagatgc aaagcgcctg      1560
     aattttctga ctcttcccat cagacccccc aaagacacac gtgacccacc accccatctc      1620
     tgaccatgag gccaccctga ggtgctgggc cctgggcttc taccctgcgg agatcacact      1680
     gacctggcag cgggatggcg aggaccaaac tcaggacact gagcttgtgg agaccagacc      1740
     agcaggagat agaaccttcc agaagtgggc agctgtggtg gtgccttctg gagaagagca      1800
     gagatacaca tgccatgtac agcatgaggg gctgccgaag cccctcaccc tgagatgggg      1860
     taaggagggg gatgaggggt catatctctt ctcagggaaa gcaggagccc ttcagcaggg      1920
     tcagggcccc tcatcttccc ttcctttccc agagccgtct tcccagtcca ccgtccccat      1980
     cgtgggcatt gttgctggcc tggctgtcct agcagttgtg gtcatcggag ctgtggtcgc      2040
     tgctgtgatg tgtaggagga agagctcagg tagggaaggg gtgaggggtg gggtctgagt      2100
     tttcttgtcc cactgggggt ttcaagcccc aggtagaagt gttccctgcc tcattactgg      2160
     ga                                                                     2162
//