Dbfetch

ID   AY672649; SV 1; linear; genomic DNA; STD; HUM; 283 BP.
XX
AC   AY672649;
XX
DT   28-JUL-2004 (Rel. 80, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens MHC class II antigen (HLA-DQB1) gene, HLA-DQB1*06 variant
DE   allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-283
RA   Chang Y.;
RT   "Identification of a novel HLA-DQB1*06 variant";
RL   Unpublished.
XX
RN   [2]
RP   1-283
RA   Chang Y.;
RT   ;
RL   Submitted (30-JUN-2004) to the INSDC.
RL   7050, All Children's Hospital, 801 6th Street South, St.Petersburg, FL
RL   33701, USA
XX
DR   MD5; 5df6610a5f9942ebe904491c10a36dee.
DR   Ensembl-Gn; ENSG00000225824; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231286; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233209; homo_sapiens.
DR   Ensembl-Tr; ENST00000399088; homo_sapiens.
DR   Ensembl-Tr; ENST00000413089; homo_sapiens.
DR   Ensembl-Tr; ENST00000416192; homo_sapiens.
DR   Ensembl-Tr; ENST00000419914; homo_sapiens.
DR   Ensembl-Tr; ENST00000422950; homo_sapiens.
DR   Ensembl-Tr; ENST00000424806; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..283
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>283
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*06 variant"
FT   mRNA            <1..>283
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*06 variant"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>283
FT                   /codon_start=1
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*06 variant"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:P01920"
FT                   /db_xref="HGNC:HGNC:4944"
FT                   /db_xref="IMGT/HLA:DQB1*06:22:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:1JK8"
FT                   /db_xref="PDB:1NBN"
FT                   /db_xref="PDB:1S9V"
FT                   /db_xref="PDB:1UVQ"
FT                   /db_xref="PDB:2NNA"
FT                   /db_xref="PDB:4GG6"
FT                   /db_xref="PDB:4OZF"
FT                   /db_xref="PDB:4OZG"
FT                   /db_xref="PDB:4OZH"
FT                   /db_xref="PDB:4OZI"
FT                   /db_xref="UniProtKB/Swiss-Prot:P01920"
FT                   /protein_id="AAT77952.1"
FT                   /translation="RDSPEDFVFQFKGMCYFTNGTERVRLVTRYIYNREEYARFDSDVG
FT                   VYRAVTPQGRPVAEYWNSQKEVLERTRAELDTVCRHNYEVGYRGILQRR"
XX
SQ   Sequence 283 BP; 62 A; 69 C; 104 G; 48 T; 0 other;
     agagactctc ccgaggattt cgtgttccag tttaagggca tgtgctactt caccaacggg        60
     acggagcgcg tgcgtcttgt gaccagatac atctataacc gagaggagta cgcgcgcttc       120
     gacagcgacg tgggggtgta ccgggcggtg acgccgcagg ggcggcctgt tgccgagtac       180
     tggaacagcc agaaggaagt cctggagagg acccgggcgg agttggacac ggtgtgcaga       240
     cacaactacg aggtggggta ccgcgggatc ctgcagagga gag                         283
//