spacer

EBI Dbfetch

ID   AY664400; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AY664400;
XX
DT   24-JUL-2004 (Rel. 80, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1-DRB1*110401
DE   variant allele, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Lazaro A.M., Hurley C.K.;
RT   "Novel Class II allele";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Lazaro A.M., Hurley C.K.;
RT   ;
RL   Submitted (24-JUN-2004) to the INSDC.
RL   Oncology, Georgetown University, 3970 Reservoir Road, NW, Washington, DC
RL   20057, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="DRB1*110401 variant"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="DRB1*110401 variant"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="DRB1*110401 variant"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q6BDC8"
FT                   /db_xref="IMGT/HLA:DRB1*11:54:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BDC8"
FT                   /protein_id="AAT76040.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEFRAV
FT                   TELGRPDEEYWNSQKDFLEDRRAEVDTYCRHNYGVVESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="DRB1*110401 variant"
FT                   /number=2
XX
SQ   Sequence 270 BP; 59 A; 60 C; 97 G; 54 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgatga ggagtactgg aacagccaga       180
     aggacttcct ggaagacagg cgggccgagg tggacaccta ttgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer