spacer

EBI Dbfetch

ID   AY656683; SV 1; linear; mRNA; STD; HUM; 786 BP.
XX
AC   AY656683;
XX
DT   01-JAN-2005 (Rel. 82, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Homo sapiens MHC class II antigen (HLA-DQB1) mRNA, HLA-DQB1*0401 allele,
DE   complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-786
RA   Kim E., Lee E., Kwack K.;
RT   ;
RL   Submitted (17-JUN-2004) to the INSDC.
RL   National Genome Research Institute, National Institute of Health, 5
RL   Nokbun-dong, Eunpyung-gu, Seoul 122-701, Republic of Korea
XX
DR   MD5; 472fc9cad6f04f4e262bb5954a7f2cdd.
DR   Ensembl-Gn; ENSG00000225824; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231286; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233209; homo_sapiens.
DR   Ensembl-Tr; ENST00000399088; homo_sapiens.
DR   Ensembl-Tr; ENST00000413089; homo_sapiens.
DR   Ensembl-Tr; ENST00000416192; homo_sapiens.
DR   Ensembl-Tr; ENST00000419914; homo_sapiens.
DR   Ensembl-Tr; ENST00000422950; homo_sapiens.
DR   Ensembl-Tr; ENST00000424806; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..786
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   gene            1..786
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*0401"
FT   CDS             1..786
FT                   /codon_start=1
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*0401"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:P01920"
FT                   /db_xref="H-InvDB:HIT000332072_04.4"
FT                   /db_xref="HGNC:HGNC:4944"
FT                   /db_xref="IMGT/HLA:DQB1*04:01:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:1JK8"
FT                   /db_xref="PDB:1NBN"
FT                   /db_xref="PDB:1S9V"
FT                   /db_xref="PDB:1UVQ"
FT                   /db_xref="PDB:2NNA"
FT                   /db_xref="PDB:4GG6"
FT                   /db_xref="PDB:4OZF"
FT                   /db_xref="PDB:4OZG"
FT                   /db_xref="PDB:4OZH"
FT                   /db_xref="PDB:4OZI"
FT                   /db_xref="UniProtKB/Swiss-Prot:P01920"
FT                   /protein_id="AAV71030.1"
FT                   /translation="MSWKKALRIPGGLRVATVTLMLAMLSAPVAEGRDSPEDFVFQFKG
FT                   MCYFTNGTELVRGVTRYIYNREEYARFDSDVGVYRAVTPLGRLDAEYWNSQKDILEEDR
FT                   ASVDTVCRHNYQLELRTTLQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPAQIKVRW
FT                   FRNDQEETTGVVSTPLIRNGDWTFQILVMLEMTPQRGDVYTCHVEHPSLQNPIIVEWRA
FT                   QSESAQSKMLSGIGGFVLGLIFLGLGLIIHHRSQKGLLH"
XX
SQ   Sequence 786 BP; 165 A; 220 C; 245 G; 156 T; 0 other;
     atgtcttgga agaaggcttt gcggatccct ggaggccttc gggtagcaac tgtgaccttg        60
     atgctggcga tgctgagcgc cccggtggct gagggcagag actctcccga ggatttcgtg       120
     ttccagttta agggcatgtg ctacttcacc aacgggaccg agctcgtgcg gggtgtgacc       180
     agatacatct ataaccgaga ggagtacgcg cgcttcgaca gcgacgtggg ggtgtatcgg       240
     gcggtgacgc cgctggggcg gcttgacgcc gagtactgga atagccagaa ggacatcctg       300
     gaggaggacc gggcgtcggt ggacaccgta tgcagacaca actaccagtt ggagctccgc       360
     acgaccttgc agcggcgagt ggagcccaca gtgaccatct ccccatccag gacagaggcc       420
     ctcaaccacc acaacctgct ggtctgctca gtgacagatt tctatccagc ccagatcaaa       480
     gtccggtggt ttcggaatga ccaggaggag acaactggcg ttgtgtccac cccccttatt       540
     aggaacggtg actggacctt ccagatcctg gtgatgctgg aaatgactcc ccagcgtgga       600
     gacgtctaca cctgccacgt ggagcacccc agcctccaga accccatcat cgtggagtgg       660
     cgggctcagt ctgaatctgc ccagagcaag atgctgagtg gcattggagg cttcgtgctg       720
     gggctgatct tcctcgggct gggccttatt atccatcaca ggagtcagaa agggctcctg       780
     cactga                                                                  786
//


spacer
spacer