spacer

EBI Dbfetch

ID   AY656682; SV 1; linear; mRNA; STD; HUM; 786 BP.
XX
AC   AY656682;
XX
DT   01-JAN-2005 (Rel. 82, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Homo sapiens MHC class II antigen (HLA-DQB1) mRNA, HLA-DQB1*030101 allele,
DE   complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-786
RA   Kim E., Lee E., Kwack K.;
RT   ;
RL   Submitted (17-JUN-2004) to the INSDC.
RL   National Genome Research Institute, National Institute of Health, 5
RL   Nokbun-dong, Eunpyung-gu, Seoul 122-701, Republic of Korea
XX
DR   MD5; 7d7836fe76bc4472b122d116867d3b91.
DR   Ensembl-Gn; ENSG00000225824; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231286; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233209; homo_sapiens.
DR   Ensembl-Tr; ENST00000399088; homo_sapiens.
DR   Ensembl-Tr; ENST00000413089; homo_sapiens.
DR   Ensembl-Tr; ENST00000416192; homo_sapiens.
DR   Ensembl-Tr; ENST00000419914; homo_sapiens.
DR   Ensembl-Tr; ENST00000422950; homo_sapiens.
DR   Ensembl-Tr; ENST00000424806; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..786
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   gene            1..786
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*030101"
FT   CDS             1..786
FT                   /codon_start=1
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*030101"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:P01920"
FT                   /db_xref="H-InvDB:HIT000332071_03.4"
FT                   /db_xref="HGNC:HGNC:4944"
FT                   /db_xref="IMGT/HLA:DQB1*03:01:01:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:1JK8"
FT                   /db_xref="PDB:1NBN"
FT                   /db_xref="PDB:1S9V"
FT                   /db_xref="PDB:1UVQ"
FT                   /db_xref="PDB:2NNA"
FT                   /db_xref="PDB:4GG6"
FT                   /db_xref="PDB:4OZF"
FT                   /db_xref="PDB:4OZG"
FT                   /db_xref="PDB:4OZH"
FT                   /db_xref="PDB:4OZI"
FT                   /db_xref="UniProtKB/Swiss-Prot:P01920"
FT                   /protein_id="AAV71029.1"
FT                   /translation="MSWKKALRIPGGLRAATVTLMLAMLSTPVAEGRDSPEDFVYQFKA
FT                   MCYFTNGTERVRYVTRYIYNREEYARFDSDVEVYRAVTPLGPPDAEYWNSQKEVLERTR
FT                   AELDTVCRHNYQLELRTTLQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPAQIKVRW
FT                   FRNDQEETTGVVSTPLIRNGDWTFQILVMLEMTPQHGDVYTCHVEHPSLQNPITVEWRA
FT                   QSESAQSKMLSGIGGFVLGLIFLGLGLIIHHRSQKGLLH"
XX
SQ   Sequence 786 BP; 173 A; 227 C; 236 G; 150 T; 0 other;
     atgtcttgga aaaaggcttt gcggatcccc ggaggccttc gggcagcaac tgttaccttg        60
     atgctggcga tgctgagcac cccagtggct gagggcagag actctcccga ggatttcgtg       120
     taccagttta aggccatgtg ctacttcacc aacgggacgg agcgcgtgcg ttatgtgacc       180
     agatacatct ataaccgaga ggagtacgca cgcttcgaca gcgacgtgga ggtgtaccgg       240
     gcggtgacgc cgctggggcc gcctgacgcc gagtactgga acagccagaa ggaagtcctg       300
     gagaggaccc gggcggagtt ggacacggtg tgcagacaca actaccagtt ggagctccgc       360
     acgaccttgc agcggcgagt ggagcccaca gtgaccatct ccccatccag gacagaggcc       420
     ctcaaccacc acaacctgct ggtctgctca gtgacagatt tctatccagc ccagatcaaa       480
     gtccggtggt ttcggaatga ccaggaggag acaaccggcg ttgtgtccac cccccttatt       540
     aggaacggtg actggacctt ccagatcctg gtgatgctgg aaatgactcc ccagcatgga       600
     gacgtctaca cctgccacgt ggagcacccc agcctccaga accccatcac cgtggagtgg       660
     cgggctcagt ctgaatctgc ccagagcaag atgctgagtg gcattggagg cttcgtgctg       720
     gggctcatct tcctcgggct gggccttatt atccatcaca ggagtcagaa agggctcctg       780
     cactga                                                                  786
//


spacer
spacer