spacer

EBI Dbfetch

ID   AY656681; SV 1; linear; mRNA; STD; HUM; 786 BP.
XX
AC   AY656681;
XX
DT   01-JAN-2005 (Rel. 82, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Homo sapiens MHC class II antigen (HLA-DQB1) mRNA, HLA-DQB1*050201 allele,
DE   complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-786
RA   Kim E., Lee E., Kwack K.;
RT   ;
RL   Submitted (17-JUN-2004) to the INSDC.
RL   National Genome Research Institute, National Institute of Health, 5
RL   Nokbun-dong, Eunpyung-gu, Seoul 122-701, Republic of Korea
XX
DR   MD5; a58dbdf587bcf5554ca745eebfadec02.
DR   Ensembl-Gn; ENSG00000225824; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231286; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233209; homo_sapiens.
DR   Ensembl-Tr; ENST00000399088; homo_sapiens.
DR   Ensembl-Tr; ENST00000413089; homo_sapiens.
DR   Ensembl-Tr; ENST00000416192; homo_sapiens.
DR   Ensembl-Tr; ENST00000419914; homo_sapiens.
DR   Ensembl-Tr; ENST00000422950; homo_sapiens.
DR   Ensembl-Tr; ENST00000424806; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..786
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   gene            1..786
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*050201"
FT   CDS             1..786
FT                   /codon_start=1
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*050201"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:P01920"
FT                   /db_xref="H-InvDB:HIT000332070.11"
FT                   /db_xref="HGNC:HGNC:4944"
FT                   /db_xref="IMGT/HLA:DQB1*05:02:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:1JK8"
FT                   /db_xref="PDB:1NBN"
FT                   /db_xref="PDB:1S9V"
FT                   /db_xref="PDB:1UVQ"
FT                   /db_xref="PDB:2NNA"
FT                   /db_xref="PDB:4GG6"
FT                   /db_xref="PDB:4OZF"
FT                   /db_xref="PDB:4OZG"
FT                   /db_xref="PDB:4OZH"
FT                   /db_xref="PDB:4OZI"
FT                   /db_xref="UniProtKB/Swiss-Prot:P01920"
FT                   /protein_id="AAV71028.1"
FT                   /translation="MSWKKSLRIPGDLRVATVTLMLAILSSSLAEGRDSPEDFVYQFKG
FT                   LCYFTNGTERVRGVTRHIYNREEYVRFDSDVGVYRAVTPQGRPSAEYWNSQKEVLEGAR
FT                   ASVDRVCRHNYEVAYRGILQRRVEPTVTISPSRTEALNHHNLLICSVTDFYPSHIKVRW
FT                   FRNDQEETAGVVSTPLIRNGDWTFQILVMLEMTPQRGDVYTCHVEHPSLQSPITVEWRA
FT                   QSESAQSKMLSGVGGFVLGLIFLGLGLIIRQRSRKGLLH"
XX
SQ   Sequence 786 BP; 164 A; 219 C; 251 G; 152 T; 0 other;
     atgtcttgga agaagtcttt gcggatcccc ggagaccttc gggtagcaac tgtcaccttg        60
     atgctggcga tcctgagctc ctcactggct gagggcagag actctcccga ggatttcgtg       120
     taccagttta agggcctgtg ctacttcacc aacgggacgg agcgcgtgcg gggtgtgacc       180
     agacacatct ataaccgaga ggagtacgtg cgcttcgaca gcgacgtggg ggtgtaccgg       240
     gcggtgacgc cgcaggggcg gcctagcgcc gagtactgga acagccagaa ggaagtcctg       300
     gagggggccc gggcgtcggt ggacagagtg tgcagacaca actacgaggt ggcgtaccgc       360
     gggatcctgc agaggagagt ggagcccaca gtgaccatct ccccatccag gacagaggcc       420
     ctcaaccacc acaacctgct gatctgctcg gtgacagatt tctatccaag ccacatcaaa       480
     gtccggtggt ttcggaatga tcaggaggag acagccggcg ttgtgtccac ccccctcatt       540
     aggaacggtg actggacctt ccagatcctg gtgatgctgg aaatgactcc ccagcgtgga       600
     gatgtctaca cctgccacgt ggagcacccc agcctccaga gccccatcac cgtggagtgg       660
     cgggctcagt ctgaatctgc ccagagcaag atgctgagtg gcgttggagg cttcgtgctg       720
     gggctgatct tccttgggct tggccttatc atccgtcaaa ggagtcggaa agggcttctg       780
     cactga                                                                  786
//


spacer
spacer