spacer

EBI Dbfetch

ID   AY656680; SV 1; linear; mRNA; STD; HUM; 777 BP.
XX
AC   AY656680;
XX
DT   01-JAN-2005 (Rel. 82, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Homo sapiens MHC class II antigen (HLA-DPB1) mRNA, HLA-DPB1*1301 allele,
DE   complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-777
RA   Lee E., Kim E., Kwack K.;
RT   ;
RL   Submitted (17-JUN-2004) to the INSDC.
RL   National Genome Research Institute, National Institute of Health, 5
RL   Nokbun-dong, Eunpyung-gu, Seoul 122-701, Republic of Korea
XX
DR   MD5; ae43bfbe97095c06d270f06e5d173501.
DR   Ensembl-Gn; ENSG00000215048; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223865; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226826; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230763; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236693; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237710; homo_sapiens.
DR   Ensembl-Tr; ENST00000399500; homo_sapiens.
DR   Ensembl-Tr; ENST00000411749; homo_sapiens.
DR   Ensembl-Tr; ENST00000418931; homo_sapiens.
DR   Ensembl-Tr; ENST00000425130; homo_sapiens.
DR   Ensembl-Tr; ENST00000433800; homo_sapiens.
DR   Ensembl-Tr; ENST00000454006; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..777
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   gene            1..777
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*1301"
FT   CDS             1..777
FT                   /codon_start=1
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*1301"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:P04440"
FT                   /db_xref="H-InvDB:HIT000332069.10"
FT                   /db_xref="HGNC:HGNC:4940"
FT                   /db_xref="IMGT/HLA:DPB1*13:01:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:3LQZ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P04440"
FT                   /protein_id="AAV71027.1"
FT                   /translation="MMVLQVSAAPRTVALTALLMVLLTSVVQGRATPENYVYQLRQECY
FT                   AFNGTQRFLERYIYNREEYARFDSDVGEFRAVTELGRPAAEYWNSQKDILEEERAVPDR
FT                   ICRHNYELDEAVTLQRRVQPKVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQ
FT                   EETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDVYICQVEHTSLDSPVTVEWKAQSDSA
FT                   RSKTLTGAGGFVLGLIICGVGIFMHRRSKKVQRGSA"
XX
SQ   Sequence 777 BP; 176 A; 206 C; 250 G; 145 T; 0 other;
     atgatggttc tgcaggtttc tgcggccccc cggacagtgg ctctgacggc gttactgatg        60
     gtgctgctca catctgtggt ccagggcagg gccactccag agaattacgt gtaccagtta       120
     cggcaggaat gctacgcgtt taatgggaca cagcgcttcc tggagagata catctacaac       180
     cgggaggagt acgcgcgctt cgacagcgac gtgggggagt tccgggcggt gacggagctg       240
     gggcggcctg ctgcggagta ctggaacagc cagaaggaca tcctggagga ggagcgggca       300
     gtgccggaca ggatatgcag acacaactac gagctggacg aggccgtgac cctgcagcgc       360
     cgagtccagc ctaaggtgaa cgtttccccc tccaagaagg ggcccctgca gcaccacaac       420
     ctgcttgtct gccacgtgac agatttctac ccaggcagca ttcaagtccg atggttcctg       480
     aatggacagg aggaaacagc tggggtcgtg tccaccaacc tgatccgtaa tggagactgg       540
     accttccaga tcctggtgat gctggaaatg accccccagc agggagacgt ctacatctgc       600
     caagtggagc acaccagcct ggacagtcct gtcaccgtgg agtggaaggc acagtctgat       660
     tctgcccgga gtaagacatt gacgggagct gggggcttcg tgctggggct catcatctgt       720
     ggagtgggca tcttcatgca caggaggagc aagaaagttc aacgaggatc tgcataa          777
//


spacer
spacer