spacer

EBI Dbfetch

ID   AY656678; SV 1; linear; mRNA; STD; HUM; 777 BP.
XX
AC   AY656678;
XX
DT   01-JAN-2005 (Rel. 82, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Homo sapiens MHC class II antigen (HLA-DPB1) mRNA, HLA-DPB1*0202 allele,
DE   complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-777
RA   Lee E., Kim E., Kwack K.;
RT   ;
RL   Submitted (17-JUN-2004) to the INSDC.
RL   National Genome Research Institute, National Institute of Health, 5
RL   Nokbun-dong, Eunpyung-gu, Seoul 122-701, Republic of Korea
XX
DR   MD5; b256fe1b9cd91efaaf3d45b8052f69a2.
DR   Ensembl-Gn; ENSG00000215048; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223865; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226826; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230763; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236693; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237710; homo_sapiens.
DR   Ensembl-Tr; ENST00000399500; homo_sapiens.
DR   Ensembl-Tr; ENST00000411749; homo_sapiens.
DR   Ensembl-Tr; ENST00000418931; homo_sapiens.
DR   Ensembl-Tr; ENST00000425130; homo_sapiens.
DR   Ensembl-Tr; ENST00000433800; homo_sapiens.
DR   Ensembl-Tr; ENST00000454006; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..777
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   gene            1..777
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*0202"
FT   CDS             1..777
FT                   /codon_start=1
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*0202"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:P04440"
FT                   /db_xref="H-InvDB:HIT000332067.10"
FT                   /db_xref="HGNC:HGNC:4940"
FT                   /db_xref="IMGT/HLA:DPB1*02:02"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:3LQZ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P04440"
FT                   /protein_id="AAV71025.1"
FT                   /translation="MMVLQVSAAPRTVALTALLMVLLTSVVQGRATPENYLFQGRQECY
FT                   AFNGTQRFLERYIYNREELVRFDSDVGEFRAVTELGRPEAEYWNSQKDILEEERAVPDR
FT                   MCRHNYELGGPMTLQRRVQPRVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQ
FT                   EETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDVYTCQVEHTSLDSPVTVEWKAQSDSA
FT                   RSKTLTGAGGFVLGLIICGVGIFMHRRSKKVQRGSA"
XX
SQ   Sequence 777 BP; 171 A; 204 C; 254 G; 148 T; 0 other;
     atgatggttc tgcaggtttc tgcggccccc cggacagtgg ctctgacggc gttactgatg        60
     gtgctgctca catctgtggt ccagggcagg gccactccag agaattacct tttccaggga       120
     cggcaggaat gctacgcgtt taatgggaca cagcgcttcc tggagagata catctacaac       180
     cgggaggagc tcgtgcgctt cgacagcgac gtgggggagt tccgggcggt gacggagctg       240
     gggcggcctg aggcggagta ctggaacagc cagaaggaca tcctggagga ggagcgggca       300
     gtgccggaca ggatgtgcag acacaactac gagctgggcg ggcccatgac cctgcagcgc       360
     cgagtccagc ctagggtgaa tgtttccccc tccaagaagg ggcccttgca gcaccacaac       420
     ctgcttgtct gccacgtgac ggatttctac ccaggcagca ttcaagtccg atggttcctg       480
     aatggacagg aggaaacagc tggggtcgtg tccaccaacc tgatccgtaa tggagactgg       540
     accttccaga tcctggtgat gctggaaatg accccccagc agggagatgt ctacacctgc       600
     caagtggagc acaccagcct ggatagtcct gtcaccgtgg agtggaaggc acagtctgat       660
     tctgcccgga gtaagacatt gacgggagct gggggcttcg tgctggggct catcatctgt       720
     ggagtgggca tcttcatgca caggaggagc aagaaagttc aacgaggatc tgcataa          777
//


spacer
spacer