spacer

EBI Dbfetch

ID   AY645772; SV 1; linear; genomic DNA; STD; HUM; 5590 BP.
XX
AC   AY645772;
XX
DT   19-JUL-2004 (Rel. 80, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens isolate CEPH1416 MHC class Ib antigen (HLA-G) gene, HLA-G*0103
DE   allele, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-5590
RX   DOI; 10.1007/s00251-005-0076-z.
RX   PUBMED; 16570139.
RA   Pyo C.W., Williams L.M., Moore Y., Hyodo H., Li S.S., Zhao L.P.,
RA   Sageshima N., Ishitani A., Geraghty D.E.;
RT   "HLA-E, HLA-F, and HLA-G polymorphism: genomic sequence defines haplotype
RT   structure and variation spanning the nonclassical class I genes";
RL   Immunogenetics 58(4):241-251(2006).
XX
RN   [2]
RP   1-5590
RA   Pyo C.-W., Ishitani A., Moore Y.F., Geraghty D.E.;
RT   ;
RL   Submitted (04-JUN-2004) to the INSDC.
RL   Clinical Division, Fred Hutchinson Cancer Research Center, 1100 Fairview
RL   Ave. N., D4-100, Seattle, WA 98109-1024, USA
XX
DR   MD5; 570aa35990f65e1903e6eecd4041cd6c.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5590
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="CEPH1416"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1202..>3739
FT                   /gene="HLA-G"
FT                   /allele="HLA-G*0103"
FT   mRNA            join(<1202..1274,1404..1673,1900..2175,2775..3050,
FT                   3173..3289,3735..>3739)
FT                   /gene="HLA-G"
FT                   /allele="HLA-G*0103"
FT                   /product="MHC class Ib antigen"
FT   CDS             join(1202..1274,1404..1673,1900..2175,2775..3050,
FT                   3173..3289,3735..3739)
FT                   /codon_start=1
FT                   /gene="HLA-G"
FT                   /allele="HLA-G*0103"
FT                   /product="MHC class Ib antigen"
FT                   /db_xref="GOA:Q8MH47"
FT                   /db_xref="IMGT/HLA:G*01:03:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q8MH47"
FT                   /protein_id="AAT73255.1"
FT                   /translation="MVVMAPRTLFLLLSGALTLTETWAGSHSMRYFSAAVSRPGRGEPR
FT                   FIAMGYVDDSQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQT
FT                   LRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTA
FT                   AQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYE
FT                   ATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD"
XX
SQ   Sequence 5590 BP; 1236 A; 1434 C; 1536 G; 1384 T; 0 other;
     gaggaaagaa ttccaaagca gcggaactct taggtttaaa cacattgttt tatagatttt        60
     aatgcatcca tctacagagc ctcgctgggt gttctttgca gttggccttt aatatcttat       120
     gtgggtctgc ctagaaacta attgtttttt atgttaatca ggtttaaaaa atactaagta       180
     ttcctaaaaa atatacactc cactcacatg tggatacttc ctaaaaacag gcagtgcgtg       240
     agcactagtg aggggcattg tgactgcact gaacacttac aactgtgagg tgaataaagt       300
     ttgtgctggc tcctggttgc aacatatagt aacatagtgt ggtactttgt cttgaggaga       360
     tgtcctggac tcacacggaa acttagggct acggaatgaa ggtaaattta aaataaaaca       420
     agcgggagtc acagatacac tgtctgggaa agtgaaactt aagagctttg tgagtcttgt       480
     tgtaatgctt ttagatgcat ttatatacca acaggccaaa gtcacatttt ttaccgatta       540
     gattcctgat cattcagggg ttaccaaggt tatgctaccc actatagtta ataaacaaaa       600
     agcaaactgg tctctattct atctcatgca ctcaggcaca acttttccag atttaagggg       660
     gaaaaaaaac cctgtcttta cacctacaat ccgagggcga gctcactctc tggcaacaag       720
     ctccgtgggg tgatttttct tctagaagag tacaggagga caggcaagga gtgggaggca       780
     gggagtccag ttcagggaca gagattccgg aatgaaaagt gaagggagag ggacagggac       840
     cttgccgagg gtttctccct ggtttctcag acagctcctg ggccaagact cagggagaca       900
     ctgagacaga acgcttggca caagagtagc ggggtcaggg cgaagtccca gggcctcaag       960
     cgtggctctc agggtctcag gccccacagg cggtgtatgg gttggggagg ccccgcgttg      1020
     gggattctct cctccttctc ctaacctgtg tcgggtcctt cttcctggat actcaccggg      1080
     cggccccagt tctcactccc attaggtgac aggtttttag agaagccaat cagcgtcgcc      1140
     gcggttctgg ttctaaagtc ctcgctcacc cacccggact cattctcccc agacgccaag      1200
     gatggtggtc atggcgcccc gaaccctctt cctgctgctc tcgggggccc tgaccctgac      1260
     cgagacctgg gcgggtgagt gcggggtcag gagggaaacg gcccctgcgc ggaggaggga      1320
     ggggccggcc cggcgggggc gcaggacccg gcagccgcgc cgggaggagg gtcgggcggg      1380
     tctcaacccc tcctcgcccc caggctccca ctccatgagg tatttcagcg ccgccgtgtc      1440
     ccggcccggc cgcggggagc cccgcttcat cgccatgggc tacgtggacg actcgcagtt      1500
     cgtgcggttc gacagcgact cggcgtgtcc gaggatggag ccgcgggcgc cgtgggtgga      1560
     gcaggagggg ccggagtatt gggaagagga gacacggaac accaaggccc acgcacagac      1620
     tgacagaatg aacctgcaga ccctgcgcgg ctactacaac cagagcgagg ccagtgagta      1680
     acccctgccc agggcgcaga tcacgacacc cacctccatg ccccacggac ggcccgggta      1740
     ctcccgagtc tccgggtctg ggatccaccc cgaggccgcg ggacccgccc agaccctcta      1800
     cctgggagaa ccccaaggcg cctttaccaa aatccctgcg ggtgtgtccg ggcgagggcg      1860
     aggctcggtg ggcggggctg accgaggggg tggggccagg ttctcacacc ctccagtgga      1920
     tgattggctg cgacctgggg tccgacggac gcctcctccg cgggtatgaa cagtatgcct      1980
     acgatggcaa ggattacctc gccctgaacg aggacctgcg ctcctggacc gcagcggaca      2040
     ctgcggctca gatctccaag cgcaagtgtg aggcggccaa tgtggctgaa caaaggagag      2100
     cctacctgga gggcacgtgc gtggagtggc tccacagata cctggagaac gggaaggaga      2160
     tgctgcagcg cgcgggtacc aggggcagtg gggcgcctcc ctgatctcct gtagacctcc      2220
     cagcctggcc tagcacaagg agaggaggaa aatgtgacca acactagaat atcgccctcc      2280
     ctctggtcct gagggagagg aatcctcctg ggtttccaga tcctgtacca gagagtgatt      2340
     ctgagggtcc gtcctgctct ctgggacaat taagggatga agtctctgag ggagtggagg      2400
     ggaagacaat ccctggaaga ctgatcaggg gttccctttg accccacagc agccttggca      2460
     ccaggacttt tcccctcagg ccttgttctc tgcctcacac tcaatgtgtg tgggagtctg      2520
     actccagctc ctctgagtcc cttggcctcc actcaggtca gaaccggagg tccctgctcc      2580
     cccgctcaga gactagaact ttccaaggaa taggagatta tcccaggtgc ccgtgtccag      2640
     gctggtgtct gggttctgtg ctcccttccc caccccaggt atctggttca ttcttaggat      2700
     ggtcacatcc aggtgctgct ggagtgtccc atgacagatg caaagtgctt gagttttctg      2760
     actcttcctt tcagaccccc ccaagacaca tgtgacccac caccctgtct ttgactatga      2820
     ggccaccctg aggtgctggg ccctgggctt ctaccctgcg gagatcatac tgacctggca      2880
     gcgggatggg gaggaccaga cccaggacgt ggagctcgtg gagaccaggc ctgcagggga      2940
     tggaaccttc cagaagtggg cagctgtggt ggtgccttct ggagaggagc agagatacac      3000
     gtgccatgtg cagcatgagg ggctgccgga gcccctcatg ctgagatgga gtaaggaggg      3060
     agatggaggc atcatgtctg ttagggaaag caggagcctc tctgaagacc tttaacaggg      3120
     tcggtggtga gggctggggg tcagagaccc tcaccttcac ctcctttccc agagcagtct      3180
     tccctgccca ccatccccat catgggtatc gttgctggcc tggttgtcct tgcagctgta      3240
     gtcactggag ctgcggtcgc tgctgtgctg tggaggaaga agagctcagg taaggaaggg      3300
     gtgacaagtg gggtctgagt tttcttgtcc cactgggggt ttcaagcccc aggtagaagt      3360
     gtgccctgcc tggttactgg gaagcaccat ccacactcat gggcctaccc agcctgggcc      3420
     ctgtgtgcca gcaccttctc ttttgtaaag cacctgtgac aatgaaggac agatttatta      3480
     ccttgatgat tgtagtgatg gggacctgat cccagtaatc acaggtcagg agaaggtccc      3540
     tggctaagga cagaccttag gagggcagtt ggtcgaggac ccacatctgc tttccttgtt      3600
     tttcctgatc ccgccctggg tctgcagtca cacatttctg gaaacttctc gagggtccaa      3660
     gactaggagg ttcctctagg acctcatggc cctgccacct ttctggcctc tcacaggaca      3720
     ttttcttccc acagattgaa aaggagggag ctactctcag gctgcaagta agtatgaagg      3780
     aggctgatcc ctgagatcct tgggatcttg tgtttgggag cccatggggg agctcaccca      3840
     ccccacaatt cctcctctgg ccacatctcc tgtggtctct gaccaggtgc tgtttttgtt      3900
     ctactctagg cagtgacagt gcccagggct ctaatgtgtc tctcacggct tgtaaatgtg      3960
     acaccccggg gggcctgatg tgtgtgggtt gttgagggga acagtggaca tagctgtgct      4020
     atgaggtttc tttgacttga atgtattgag catgtgatgg gctgtttaaa gtgtcacccc      4080
     tcactgtgac tgatatgaat ttgttcatga atatttttct gtagtgtgaa acagctgccc      4140
     tgtgtgggac tgagtggcaa gatttgttca tgcctccctt tgtgacttca agaaccctga      4200
     cttctctttc tgcagagacc agcccacccc tgtgtccacc atgaccctct tcctcatgct      4260
     gaactgcatt ccttccccaa tcacctttcc tgttccagaa aaggggctgg gatgtctccg      4320
     tctctgtctc aaatttgtgg tgcactgagc tataacttac ttctgtatta aaattagaat      4380
     ctgagtataa atttactttt tcaaattatt tccaagagag attgatgggt taattaaagg      4440
     agaagattcc tgaaatttga gagacaaaat aaatggaaga catgagaact ttccacagta      4500
     cacgtgtttc ttgtgctgat ttgttgcagg agaggagagt agatggggct gcgcccagtg      4560
     ggtgctcagg ccaccatgaa ctttatgtgg tcactgctca gctgggtcat ctttgctgct      4620
     ctattgtcct tggcccttca gtagaacctt gtcccaccag gacctgtgat cacatagact      4680
     tggatatcac ctagggtggt ccctacacgt agaagttcct gtgttatcag aagaaaaatt      4740
     ttcagacccc tacacctctt cccctccttc caggtctctt tcaattgtat tttccatctt      4800
     tttttttttt tttttttttt tttttttttt ttttttgaga tggagtctca ctcaggctgg      4860
     agtgcagtgg tgcaatctcg actcattgca acctccacct cccgggttca agcaattctc      4920
     ctgtctcagc ctccctagta actgggagta caggcacatg ccacaatacc cagctaattt      4980
     tttgtatttt tagtaaagac gggatttcac catgttagcc aggatggtct tgatctcctg      5040
     accttgtgat ctgcccgcct ctgcctccca aagtgctggg attacaggtg taagccacca      5100
     tgcctggctt ccccaacctt cttaaaggaa gcagattctg aaacttcccg agaggagagg      5160
     tcccagagtt tttcattgta gtttactttc tgttggaact cctcttctgc tctctctcct      5220
     actcttcttc ctgccctgag ttgtagtaat cctattgctg gctccaaacc aaactcatgg      5280
     atttgtaaag cagagtctaa tttagattca tatgtggttg gataattgga gccataagcc      5340
     ttgggttatc tttcctgaag agacaaatat ggttgtgtgc tgcagtgtgc aggaggattg      5400
     gtgtgggagg aggagggagg gagggaggac acaaaagcag ccctggtgag aaaagcactg      5460
     gtgcatttat atccacatga gataatattg ttccacagcg gctacaaaat gacatttggc      5520
     ctgagtctac attaataaag atattgcctt tagaataggg gggcgcacta cagtaatcat      5580
     ccattcaagt                                                             5590
//


spacer
spacer