spacer

EBI Dbfetch

ID   AY645771; SV 1; linear; genomic DNA; STD; HUM; 5580 BP.
XX
AC   AY645771;
XX
DT   19-JUL-2004 (Rel. 80, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens isolate CEPH1416-2 MHC class Ib antigen (HLA-G) gene,
DE   HLA-G*010101 allele, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-5580
RX   DOI; 10.1007/s00251-005-0076-z.
RX   PUBMED; 16570139.
RA   Pyo C.W., Williams L.M., Moore Y., Hyodo H., Li S.S., Zhao L.P.,
RA   Sageshima N., Ishitani A., Geraghty D.E.;
RT   "HLA-E, HLA-F, and HLA-G polymorphism: genomic sequence defines haplotype
RT   structure and variation spanning the nonclassical class I genes";
RL   Immunogenetics 58(4):241-251(2006).
XX
RN   [2]
RP   1-5580
RA   Pyo C.-W., Ishitani A., Moore Y.F., Geraghty D.E.;
RT   ;
RL   Submitted (04-JUN-2004) to the INSDC.
RL   Clinical Division, Fred Hutchinson Cancer Research Center, 1100 Fairview
RL   Ave. N., D4-100, Seattle, WA 98109-1024, USA
XX
DR   MD5; 5636015e9271e47d4408965b1326ad14.
DR   Ensembl-Gn; ENSG00000204632; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206506; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230413; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233095; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235346; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235680; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237216; homo_sapiens.
DR   Ensembl-Tr; ENST00000360323; homo_sapiens.
DR   Ensembl-Tr; ENST00000376828; homo_sapiens.
DR   Ensembl-Tr; ENST00000383621; homo_sapiens.
DR   Ensembl-Tr; ENST00000400665; homo_sapiens.
DR   Ensembl-Tr; ENST00000400682; homo_sapiens.
DR   Ensembl-Tr; ENST00000420559; homo_sapiens.
DR   Ensembl-Tr; ENST00000422371; homo_sapiens.
DR   Ensembl-Tr; ENST00000423011; homo_sapiens.
DR   Ensembl-Tr; ENST00000423373; homo_sapiens.
DR   Ensembl-Tr; ENST00000428701; homo_sapiens.
DR   Ensembl-Tr; ENST00000428952; homo_sapiens.
DR   Ensembl-Tr; ENST00000434881; homo_sapiens.
DR   Ensembl-Tr; ENST00000444098; homo_sapiens.
DR   Ensembl-Tr; ENST00000449127; homo_sapiens.
DR   Ensembl-Tr; ENST00000450984; homo_sapiens.
DR   Ensembl-Tr; ENST00000546545; homo_sapiens.
DR   Ensembl-Tr; ENST00000546634; homo_sapiens.
DR   Ensembl-Tr; ENST00000547241; homo_sapiens.
DR   Ensembl-Tr; ENST00000547931; homo_sapiens.
DR   Ensembl-Tr; ENST00000550897; homo_sapiens.
DR   Ensembl-Tr; ENST00000553052; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5580
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="CEPH1416-2"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1202..>3739
FT                   /gene="HLA-G"
FT                   /allele="HLA-G*010101"
FT   mRNA            join(<1202..1274,1404..1673,1900..2175,2775..3050,
FT                   3173..3289,3735..>3739)
FT                   /gene="HLA-G"
FT                   /allele="HLA-G*010101"
FT                   /product="MHC class Ib antigen"
FT   CDS             join(1202..1274,1404..1673,1900..2175,2775..3050,
FT                   3173..3289,3735..3739)
FT                   /codon_start=1
FT                   /gene="HLA-G"
FT                   /allele="HLA-G*010101"
FT                   /product="MHC class Ib antigen"
FT                   /db_xref="GOA:Q6DU14"
FT                   /db_xref="IMGT/HLA:G*01:01:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DU14"
FT                   /protein_id="AAT73254.1"
FT                   /translation="MVVMAPRTLFLLLSGALTLTETWAGSHSMRYFSAAVSRPGRGEPR
FT                   FIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQT
FT                   LRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTA
FT                   AQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYE
FT                   ATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD"
XX
SQ   Sequence 5580 BP; 1235 A; 1440 C; 1536 G; 1369 T; 0 other;
     gaggaaagaa ttccaaagca gcagaactct taggtttaaa cacattgttt tatagatttt        60
     aatacatcca tctacagagc ctcgctgggt gttctttgca gttggccttt aatatcttat       120
     gtgggtctgc ctagaaacta attgtttttt atgttaatca ggtttaaaaa atactaagta       180
     ttcctaaaaa atatacactc cactcacatg tggatacttc ctaaaaacag gcagtgcgtg       240
     agcactagtg aggggcattg tgactgcact gaacacttac aactgtgagg tgaataaagt       300
     ttgtgctggc tcctggttgc aacatatagt aacatagtgt ggtactttgt cttgaggaga       360
     tgtcctggac tcacacggaa acttagggct acggaatgaa ggtaaattta aaataaaaca       420
     agcgggagtc acagatacac tgtctgggaa agtgaaactt aagagctttg tgagtcctgt       480
     tgtaatgctt ttagatgcat ttatatacca acaggccaaa gtcacatttt ttaccgatta       540
     gattcctgat cattcggggg ttaccaaggt tatgctaccc actatagtta ataaacaaaa       600
     agcaaactgg tctctattct atctcatgca ctcaggcaca acttttccag atttaagggg       660
     gaaaaaaaac cctgtcttta cacctacaat cccagggcga gctcactctc tggcaacaag       720
     ctccctgggg tgatttttct tctagaagag tacaggagga caggcaagga gtgggaggca       780
     gggagtccag ttcagggaca gggattccgg gatgaaaagt gaagggagag ggccagggac       840
     cttgccgagg gtttctccct ggtttctcag acagctcctg ggccaagact cagggagaca       900
     ctgagacaga acgcttggca caagagtagc ggggtcaggg cgaagtccca gggcctcaag       960
     cgtggctctc agggtctcag gccccacagg cggtgtatgg gttggggagg ccccgcgttg      1020
     gggattctct cctccttctc ctaacctgtg tcgggtcctt cttcctggat actcaccggg      1080
     cggccccagt tctcactccc attaggtgac aggtttttag agaagccaat cagcgtcgcc      1140
     gcggtcctgg ttctaaagtc ctcgctcacc cacccggact cattctcccc agacgccaag      1200
     gatggtggtc atggcgcccc gaaccctctt cctgctgctc tcgggggccc tgaccctgac      1260
     cgagacctgg gcgggtgagt gcggggtcag gagggaaacg gcccctgcgc ggaggaggga      1320
     ggggcccgcc tggcgggggc gcaggactcg gcagccgcgc cgggaggagg gtcgggcggg      1380
     tctcaacccc tcctcgcccc caggctccca ctccatgagg tatttcagcg ccgccgtgtc      1440
     ccggcccggc cgcggggagc cccgcttcat cgccatgggc tacgtggacg acacgcagtt      1500
     cgtgcggttc gacagcgact cggcgtgtcc gaggatggag ccgcgggcgc cgtgggtgga      1560
     gcaggagggg ccggagtatt gggaagagga gacacggaac accaaggccc acgcacagac      1620
     tgacagaatg aacctgcaga ccctgcgcgg ctactacaac cagagcgagg ccagtgagta      1680
     actccggccc agggagcaga tcacgacccc cacctccatg ccccacggac ggcccgggta      1740
     ctcccgagtc tccgggtctg ggatccaccc cgaggccgcg ggacccgccc agaccctcta      1800
     cctgggagaa ccccaaggcg cctttaccaa aatccccgcg ggtgggtccg ggcgagggcg      1860
     aggctcggtg ggcggggctg accgaggggg tggggccagg ttctcacacc ctccagtgga      1920
     tgattggctg cgacctgggg tccgacggac gcctcctccg cgggtatgaa cagtatgcct      1980
     acgatggcaa ggattacctc gccctgaacg aggacctgcg ctcctggacc gcagcggaca      2040
     ctgcggctca gatctccaag cgcaagtgtg aggcggccaa tgtggctgaa caaaggagag      2100
     cctacctgga gggcacgtgc gtggagtggc tccacagata cctggagaac gggaaggaga      2160
     tgctgcagcg cgcgggtacc aggggcagtg gggcgcctcc ctgatctcct gtagacctct      2220
     cagcctggcc tagcacaagg agaggaggaa aatgggacca acactagaat atcgccctcc      2280
     ctctggtcct gagggagagg aatcctcctg ggtttccaga tcctgtacca gagagtgatt      2340
     ctgagggccc gtcctgctct ctgggacaat taagggatga agtctctgag ggagtggagg      2400
     ggaagacaat ccctggaaga ctgatcaggg gttccctttg accccacagc agccttggca      2460
     ccaggacttt tcccctcagg ccttgttctc tgcctcacac tcaatgtgtg tgggggtctg      2520
     actccagctc ctctgagtcc cttggcctcc actcaggtca gaaccggagg tccctgctcc      2580
     cccgctcaga gactagaact ttccaaggaa taggagatta tcccaggtgc ccgtgtccag      2640
     gctggtgtct gggttctgtg ctcccttccc caccccaggt atctggttca ttcttaggat      2700
     ggtcacatcc aggtgctgct ggagtgtccc atgagagatg caaagtgctt gaattttctg      2760
     actcttcctt tcagaccccc ccaagacaca cgtgacccac caccctgtct ttgactatga      2820
     ggccaccctg aggtgctggg ccctgggctt ctaccctgcg gagatcatac tgacctggca      2880
     gcgggatggg gaggaccaga cccaggacgt ggagctcgtg gagaccaggc ctgcagggga      2940
     tggaaccttc cagaagtggg cagctgtggt ggtgccttct ggagaggagc agagatacac      3000
     gtgccatgtg cagcatgagg ggctgccgga gcccctcatg ctgagatgga gtaaggaggg      3060
     agatggaggc atcatgtctg ttagggaaag caggagcctc tctgaagacc tttaacaggg      3120
     tcggtggtga gggctggggg tcagagaccc tcaccttcac ctcctttccc agagcagtct      3180
     tccctgccca ccatccccat catgggtatc gttgctggcc tggttgtcct tgcagctgta      3240
     gtcactggag ctgcggtcgc tgctgtgctg tggagaaaga agagctcagg taaggaaggg      3300
     gtgacaagtg gggtctgagt tttcttgtcc cactgggggt ttcaagcccc aggtagaagt      3360
     gtgccctgcc tggttactgg gaagcaccat ccacactcat gggcctaccc agcctgggcc      3420
     ctgtgtgcca gcaccttctc ttttgtaaag cacctgtgac aatgaaggac agatttatta      3480
     ccttgatgat tgtagtgatg gggacctgat cccagtaatc acaggtcagg agaaggtccc      3540
     tggctaagga cagaccttag gagggcagtt ggtcgaggac ccacatctgc tttccttgtt      3600
     tttcctgatc ccgccctggg tctgcagtca cacatttctg gaaacttctc gagggtccaa      3660
     gactaggagg ttcctctagg acctcatggc cctgccacct ttctggcctc tcacaggaca      3720
     ttttcttccc acagattgaa aaggagggag ctactctcag gctgcaagta agtatgaagg      3780
     aggctgatcc ctgagatcct tgggatcttg tgtttgggag cccatggggg agctcaccca      3840
     ccccacaatt cctcctctgg ccacatctcc tgtggtctct gaccaggtgc tgtttttgtt      3900
     ctactctagg cagtgacagt gcccagggct ctaatgtgtc tctcacggct tgtaaatgtg      3960
     acaccccggg gggcctgatg tgtgtgggtt gttgagggga acaggggaca tagctgtgct      4020
     atgaggtttc tttgacttca atgtattgag catgtgatgg gctgtttaaa gtgtcacccc      4080
     tcactgtgac tgatatgaat ttgttcatga atatttttct gtagtgtgaa acagctgccc      4140
     tgtgtgggac tgagtggcaa gccctttgtg acttcaagaa ccctgacttc tctttgtgca      4200
     gagaccagcc cacccctgtg cccaccatga ccctcttcct catgctgaac tgcattcctt      4260
     ccccaatcac ctttcctgtt ccagaaaagg ggctgggatg tctccgtctc tgtctcaaat      4320
     ttgtggtcca ctgagctata acttacttct gtattaaaat tagaatctga gtgtaaattt      4380
     actttttcaa attatttcca agagagattg atgggttaat taaaggagaa gattcctgaa      4440
     atttgagaga caaaataaat ggaagacatg agaactttcc acagtacacg tgtttcttgt      4500
     gctgatttgt tgcaggagag gagagtagat ggggctgcgc ccagtgggtg ctcaggccac      4560
     catgaacttt atgtggtcac tgctcagctg ggtcatcttt gctgctccat tgtccttggc      4620
     ccttcagtag aaccttgtcc caccaggacc tgtgatcaca tagacttgga tatcacctag      4680
     ggtggtccct acacgtagaa gttcctgtgt tatcagaaga aaaattttca gacccctaca      4740
     cctcttcccc tccttccagg tctctttcaa ttgtattttc catctttttt tttttttttt      4800
     tttttttttt tttttttttt ttgagatgga gtctcactca ggctggagtg cagtggtgca      4860
     atctcaactc attgcaacct ccacctcccg ggttcaagca attctcctgt ctcagcctcc      4920
     ctagtaactg ggagtacagg cacatgccac aatacccagc taattttttg tatttttagt      4980
     aaagacggga tttcaccatg ttagccagga tggtcttgat ctcctgacct tgtgatctgc      5040
     ccgcctctgc ctcccaaagt gctgggatta caggtgtaag ccaccatgcc tggcttcccc      5100
     aaccttctta aaggaagcag attctgaaac ttcccgagag gagaggtccc agagtttttc      5160
     attgtagttt actttctgtt ggaactcctc ttctgctctc tctcctactc ttcttcctgc      5220
     cctgagttgt agtaatccta ttgctggctc caaaccaaac tcatggattt gtaaagcaga      5280
     gtctaattta gattcatatg tggttggata attggagcca taagccttgg gttatctttc      5340
     ctcaagagac aaatatggtt gtgtgctgca gtgtgcagga ggattggtgt gggaggaggc      5400
     aggagggagg gagggaggac acaaaagcag ccctggtgag aaaagcactg gtgcatttat      5460
     atccacatga gataatattg ttccacagcg gctacaaaat gacatttggc ctgagtctac      5520
     attaataaag atattgcctt tagaataggg gggcgcacta cagtaatcat ccattcaagt      5580
//


spacer
spacer