spacer

EBI Dbfetch

ID   AY645767; SV 1; linear; genomic DNA; STD; HUM; 5575 BP.
XX
AC   AY645767;
XX
DT   19-JUL-2004 (Rel. 80, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens isolate CEPH1416 MHC class Ib antigen (HLA-G) gene,
DE   HLA-G*010401 variant allele, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-5575
RX   DOI; 10.1007/s00251-005-0076-z.
RX   PUBMED; 16570139.
RA   Pyo C.W., Williams L.M., Moore Y., Hyodo H., Li S.S., Zhao L.P.,
RA   Sageshima N., Ishitani A., Geraghty D.E.;
RT   "HLA-E, HLA-F, and HLA-G polymorphism: genomic sequence defines haplotype
RT   structure and variation spanning the nonclassical class I genes";
RL   Immunogenetics 58(4):241-251(2006).
XX
RN   [2]
RP   1-5575
RA   Pyo C.-W., Ishitani A., Moore Y.F., Geraghty D.E.;
RT   ;
RL   Submitted (04-JUN-2004) to the INSDC.
RL   Clinical Division, Fred Hutchinson Cancer Research Center, 1100 Fairview
RL   Ave. N., D4-100, Seattle, WA 98109-1024, USA
XX
DR   MD5; 3f7a85c9fafd3435d1ac65ee3085827d.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5575
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="CEPH1416"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1202..>3738
FT                   /gene="HLA-G"
FT                   /allele="HLA-G*010401 variant"
FT   mRNA            join(<1202..1274,1404..1673,1899..2174,2774..3049,
FT                   3172..3288,3734..>3738)
FT                   /gene="HLA-G"
FT                   /allele="HLA-G*010401 variant"
FT                   /product="MHC class Ib antigen"
FT   CDS             join(1202..1274,1404..1673,1899..2174,2774..3049,
FT                   3172..3288,3734..3738)
FT                   /codon_start=1
FT                   /gene="HLA-G"
FT                   /allele="HLA-G*010401 variant"
FT                   /product="MHC class Ib antigen"
FT                   /db_xref="GOA:Q6DU08"
FT                   /db_xref="IMGT/HLA:G*01:07"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DU08"
FT                   /protein_id="AAT73250.1"
FT                   /translation="MVVMAPRTLFLLLSGALTLTETWAGSHSMRYFSAAVFRPGRGEPR
FT                   FIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQT
FT                   LRGYYNQSEASSHTLQWMIGCDLGSDGRLIRGYEQYAYDGKDYLALNEDLRSWTAADTA
FT                   AQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYE
FT                   ATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD"
XX
SQ   Sequence 5575 BP; 1237 A; 1438 C; 1531 G; 1369 T; 0 other;
     gaggaaagaa ttccaaagca gcggaactct taggtttaaa cacattattt tatagatttt        60
     aatacatcca tctacagagc ctcgctgggt gttctttgca gttggccttt aatatcttat       120
     gtgggtctgc ctagaaacta attgtttttt atgttaatca ggtttaaaaa atactaagta       180
     ttcctaaaaa atatacactc cactcacatg tggatacttc ctaaaaacag gcagtgcatg       240
     agcactagtg aggggcattg tgactgcact gaacacttac aactgtgagg tgaataaagt       300
     ttgtgctggc tcctggttgc aacatatagt aacatagtgt ggtactttgt cttgaggaga       360
     tgtcctggac tcacacggaa acttagggct acggaatgaa ggtaaattta aaataaaaca       420
     agcgggagtc acagatacat tgtctgggaa agtgaaactt aagagctttg tgagtcctgt       480
     tgtaaggctt ttagatgcat ttatatacca acgggccaaa gtcacatttt ttacctatta       540
     gattcctgat cattcagggg ttaccaagat tatgctaccc actatagtta ataaacaaaa       600
     agcaaactgg tctctattct atctcatgca ctcaggcaca acttttccag atttaagggg       660
     gaaaaaaaac cctgtcttta cacctacaat cccagggcga gctcactctc tggcaccaag       720
     ctccgtgggg tgatttttct tctagaagag tacaggagga caggcaagga gtgggaggca       780
     gggagtccag ttcagggaca gggattccgg gatgaaaagt gaagggagag ggacagggac       840
     cttgccgagg gtttctccct ggtttctcag acagctcctg ggccaagact cagggagaca       900
     ctgagacaga acgcttggca caagagtagc ggggtcaggg cgaagtccca gggcctcaag       960
     cgtggctctc agggtctcag gccccacagg cggtgtatgg attggggagg ccccgcgttg      1020
     gggattctct cctccttctc ctaacctgtg tcgggtcctt cttcctggat actcaccggg      1080
     cggccccagt tctcactccc attaggtgac aggtttttag agaagccaat cagcgtcgcc      1140
     gcggtcctgg ttctaaagtc ctcgctcacc cacccggact cattctcccc agacgccaag      1200
     gatggtggtc atggcacccc gaaccctctt cctgctactc tcgggggccc tgaccctgac      1260
     cgagacctgg gcgggtgagt gcggggtcag gagggaaacg gcccctgcgc ggaggaggga      1320
     ggggccggcc cggcgggggc gcaggacccg gcagccgcgc cgggaggagg gtcgggcggg      1380
     tctcaacctc tcctcgcccc caggctccca ctccatgagg tatttcagcg ccgccgtgtt      1440
     ccggcccggc cgcggggagc cccgcttcat cgccatgggc tacgtggacg acacgcagtt      1500
     cgtgcggttc gacagcgact cggcgtgtcc gaggatggag ccgcgggcgc cgtgggtgga      1560
     gcaggagggg ccagagtatt gggaagagga gacacggaac accaaggccc acgcacagac      1620
     tgacagaatg aacctgcaga ccctgcgcgg ctactacaac cagagcgagg ccagtgagta      1680
     accccggccc agggcgcaga tcacgacccc cacctccatg ccccacggac gccccgggta      1740
     ctcccgagtc tccgggtctg ggatccaccc cgaggccgcg ggacccgccc agaccctcta      1800
     cctgggagaa ccccaggcgc ctttaccaaa atccctgcgg gtgggtccgg gcgagggcga      1860
     ggctcggtgg gcggggctga ccgaaggggt ggggccaggt tctcacaccc tccagtggat      1920
     gattggctgc gacctggggt ccgacggacg cctcatccgc gggtatgaac agtatgccta      1980
     cgatggcaag gattacctcg ccctgaacga ggacctgcgc tcctggaccg cagcggacac      2040
     tgcggctcag atctccaagc gcaagtgtga ggcggccaat gtggctgaac aaaggagagc      2100
     ctacctggag ggcacgtgcg tggagtggct ccacagatac ctggagaacg ggaaggagat      2160
     gctgcagcgc gcgggtacca ggggcagtgg ggcgcctccc tgatctcctg tagacctccc      2220
     agcctggcct agcacaagga gaggaggaaa atgggaccaa caccagaata tcgccctccc      2280
     tctggtcctg agggagagga atcctcctgg gtttccagat cctgtaccag agagtgattc      2340
     tgagggcccg tcctgctctc tgggacaatt aagggatgaa gtctctgagg gagtggaggg      2400
     gaagacaatc cctggaggac tgatcagggg ttccctttga ccccacagca gccttggcac      2460
     caggactttt cccctcaggc cttgttctct gcctcacact caatgtgtgt gggagtctga      2520
     ctccagctcc tctgagtccc ttggcctcca ctcaggtcag aaccagaggt ccctgctccc      2580
     ccgctcagag actagaactt tccaaggaat aggagattat cccaggtgcc cgtgtccagg      2640
     ctggtgtctg ggttctgtgc tcccttcccc accccaggta tctggttcat tcttaggatg      2700
     gtcacatcca ggtgctgctg gagtgtccca tgagagatgc aaagtgcttg agttttctga      2760
     ctcttccttt cagacccccc caagacacac gtgacccacc accctgtctt tgactatgag      2820
     gccaccctga ggtgctgggc cctgggcttc taccctgcgg agatcatact gacctggcag      2880
     cgggatgggg aggaccagac ccaggacgtg gagctcgtgg agaccaggcc tgcaggggat      2940
     ggaaccttcc agaagtgggc agctgtggtg gtgccttctg gagaggagca gagatacacg      3000
     tgccatgtgc agcatgaggg gctgccggag cccctcatgc tgagatggag taaggaggga      3060
     gatggaggca tcatgtctgt tagggaaagc aggagcctct ctgaagacct ttaacagggt      3120
     cggtggtgag gcctgggggt cagagaccct caccttcacc tcctttccca gagcagtctt      3180
     ccctgcccac catccccatc atgggtatcg ttgctggcct ggttgtcctt gcagctgtag      3240
     tcactggagc tgcggtcgct gctgtgctgt ggaggaagaa gagctcaggt aaggaagggg      3300
     tgacaagtgg ggtctgagtt ttcttgtccc actgggggtt tcaagcccca ggtagaagtg      3360
     cgccctgcct ggttactggg aagcaccatc cacactcatg ggcctaccca gcctgggccc      3420
     tgtgtgccag caccttctct tttgtaaagc acctgtgaca atgaaggaca gatttatcac      3480
     cttgatgatt gtagtgatgg ggacctgatc ctagtaatca caggtcaggg gaaggtccct      3540
     ggctaaggac agaccttagg agggcagttg gtcgaggacc cacatctgct ttccttgttt      3600
     ttcctgatcc cgccctgagt ctgcagtcac acatttctgg aaacttctcg agggtccaag      3660
     actaggaggt tcctctagga cctcatggcc ctgccacctt tctggcctct cacaggacgt      3720
     tttcttccca cagattgaaa aggagggagc tactctcagg ctgcaagtaa gtatgaagga      3780
     ggctgatccc tgagatcctt gggatcttgt gtttgggagc ccatggggga gctcacccac      3840
     cccacaattc ctcctctggc cacatctcct gtggtctctg accaggtgct gtttttgttc      3900
     tactctaggc agtgacagtg cccagggctc taatgtgtct ctcacggctt gtaaatgtga      3960
     caccccgggg ggcctgatgt gtgtgggttg ttgaggggaa cagtggacat agctgtgcta      4020
     tgaggtttct ttgacttgaa tgtattgagc atgtgatggg ctgtttaaag tgtcacccct      4080
     cactgtgact gatatgaatt tgttcatgaa tatttttctg tagtgtgaaa cagctgccct      4140
     gtgtgggact gagtggcaag ccctttgtga cttcaagaac cctgacttct ctttctgcag      4200
     agaccagccc acccctgtgc ccaccatgac cctcttcctc atgctgaact gcattccttc      4260
     cccaatcacc tttcctgttc cagaaaaggg gctgggatgt ctccgtctct gtctcaaatt      4320
     tgtggtgcac tgagctataa cttacttctg tattaaaatt agaatctgag tataaattta      4380
     ctttttcaaa ttatttccaa gagagattga tgggttaatt aaaggagaag attcctgaaa      4440
     tttgagagac aaaataaatg gaagacatga gaactttcca cagtacacgt gtttcttgtg      4500
     ctgatttgtt gcaggagagg agagtagatg gggctgcgcc cagtgggtgc tcaggccacc      4560
     atgaacttta tgtggtcact gctcagctgg gtcatctttg ctgctctatt gtccttggcc      4620
     cttcagtaga accttgtccc accaggacct gtgatcacat agacttggat atcacctagg      4680
     gtggtcccta cacgtagaag ttcctgtgtt atcagaagaa aaattttcag acccctacac      4740
     ctcttcccct ccttccaggt ctctttcaat tgtattttcc atcttttttt tttttttttt      4800
     tttttttttt tttttttttt tgagatggag tctcactcag gctggagtgc agtggtgcaa      4860
     tctcgactca ttgcaacctc cacctcccgg gttcaagcaa ttctcctgtc tcagcctccc      4920
     tagtaactgg gagtacaggc acatgccacg atacccagct aattttttgt atttttagta      4980
     aagacgggat ttcaccatgt tagccaggat ggtcttgatc tcctgacctt gtgatctgcc      5040
     cgcctctgcc tcccaaagtg ctgggattac aggtgtaagc caccatgcct ggcttcccca      5100
     accttcttaa aggaagcaga ttctgaaact tcccgagagg agaggtccca gagtttttca      5160
     ttgtagttta ctttctgttg gaactcctct tctgctctct ctcctactct tcttcctgcc      5220
     ctgagttgta gtaatcctat tgctggctcc aaaccaaact catggatttg taaagcagag      5280
     tctaatttag attcatatgt ggttggataa ttggagccat aagccttggg ttatctttcc      5340
     tgaagagaca aatatggttg tgtgctgcag tgtgcaggag gattggtgtg ggaggaggag      5400
     ggagggaggg aggacacaaa agcagccctg gtgagaaaag cactggtgca tttatatcca      5460
     catgagataa tattgttcca cagcggctac aaaatgacat ttggcctgag tctacattaa      5520
     taaagatatt gcctttagaa taggggggcg cactacagta atcatccatt caagt           5575
//


spacer
spacer