spacer

EBI Dbfetch

ID   AY645766; SV 1; linear; genomic DNA; STD; HUM; 5590 BP.
XX
AC   AY645766;
XX
DT   19-JUL-2004 (Rel. 80, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens isolate Afr-Am024 MHC class Ib antigen (HLA-G) gene,
DE   HLA-G*010102 allele, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-5590
RX   DOI; 10.1007/s00251-005-0076-z.
RX   PUBMED; 16570139.
RA   Pyo C.W., Williams L.M., Moore Y., Hyodo H., Li S.S., Zhao L.P.,
RA   Sageshima N., Ishitani A., Geraghty D.E.;
RT   "HLA-E, HLA-F, and HLA-G polymorphism: genomic sequence defines haplotype
RT   structure and variation spanning the nonclassical class I genes";
RL   Immunogenetics 58(4):241-251(2006).
XX
RN   [2]
RP   1-5590
RA   Pyo C.-W., Ishitani A., Moore Y.F., Geraghty D.E.;
RT   ;
RL   Submitted (04-JUN-2004) to the INSDC.
RL   Clinical Division, Fred Hutchinson Cancer Research Center, 1100 Fairview
RL   Ave. N., D4-100, Seattle, WA 98109-1024, USA
XX
DR   MD5; f72019465fb8b8e806e836f8ff96ab67.
DR   Ensembl-Gn; ENSG00000204632; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206506; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230413; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233095; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235346; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235680; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237216; homo_sapiens.
DR   Ensembl-Tr; ENST00000360323; homo_sapiens.
DR   Ensembl-Tr; ENST00000376828; homo_sapiens.
DR   Ensembl-Tr; ENST00000383621; homo_sapiens.
DR   Ensembl-Tr; ENST00000400665; homo_sapiens.
DR   Ensembl-Tr; ENST00000400682; homo_sapiens.
DR   Ensembl-Tr; ENST00000420559; homo_sapiens.
DR   Ensembl-Tr; ENST00000422371; homo_sapiens.
DR   Ensembl-Tr; ENST00000423011; homo_sapiens.
DR   Ensembl-Tr; ENST00000423373; homo_sapiens.
DR   Ensembl-Tr; ENST00000428701; homo_sapiens.
DR   Ensembl-Tr; ENST00000428952; homo_sapiens.
DR   Ensembl-Tr; ENST00000434881; homo_sapiens.
DR   Ensembl-Tr; ENST00000444098; homo_sapiens.
DR   Ensembl-Tr; ENST00000449127; homo_sapiens.
DR   Ensembl-Tr; ENST00000450984; homo_sapiens.
DR   Ensembl-Tr; ENST00000546545; homo_sapiens.
DR   Ensembl-Tr; ENST00000546634; homo_sapiens.
DR   Ensembl-Tr; ENST00000547241; homo_sapiens.
DR   Ensembl-Tr; ENST00000547931; homo_sapiens.
DR   Ensembl-Tr; ENST00000550897; homo_sapiens.
DR   Ensembl-Tr; ENST00000553052; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5590
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="Afr-Am024"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1202..>3739
FT                   /gene="HLA-G"
FT                   /allele="HLA-G*010102"
FT   mRNA            join(<1202..1274,1404..1673,1900..2175,2775..3050,
FT                   3173..3289,3735..>3739)
FT                   /gene="HLA-G"
FT                   /allele="HLA-G*010102"
FT                   /product="MHC class Ib antigen"
FT   CDS             join(1202..1274,1404..1673,1900..2175,2775..3050,
FT                   3173..3289,3735..3739)
FT                   /codon_start=1
FT                   /gene="HLA-G"
FT                   /allele="HLA-G*010102"
FT                   /product="MHC class Ib antigen"
FT                   /db_xref="GOA:Q6DU14"
FT                   /db_xref="IMGT/HLA:G*01:01:02:02"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DU14"
FT                   /protein_id="AAT73249.1"
FT                   /translation="MVVMAPRTLFLLLSGALTLTETWAGSHSMRYFSAAVSRPGRGEPR
FT                   FIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQT
FT                   LRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTA
FT                   AQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYE
FT                   ATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD"
XX
SQ   Sequence 5590 BP; 1237 A; 1442 C; 1532 G; 1379 T; 0 other;
     gaggaaagaa ttccaaagca gcggaactct taggtttaaa cacattgttt tatagatttt        60
     attacatcca tctacagagc ctcgctgggt gttctttgca gttggccttt aatatcttat       120
     gtgggtctgc ctagaaacta attgtttttt atgttaatca ggtttaaaaa atactaagta       180
     ttcctaaaaa atatacactc cactcacatg tggatacttc ctaaaaacag gcagtgcatg       240
     agcactagtg aggggcattg tgactgcact gaacacttac aactgtgagg tgaataaagt       300
     ttgtgctggc tcctggttgc aacatatagt aacatagtgt ggtactttgt cttgaggaga       360
     tgtcctggac tcacacggaa acttagggct acggaatgaa ggtaaattta aaataaaaca       420
     agcgggagtc acagatacat tgtctgggaa agtgaaactt aagagctttg tgagtcctgt       480
     tgtaaggctt ttagatgcat ttatatacca acgggccaaa gtcacatttt ttacctatta       540
     gattcctgat cattcagggg ttaccaagat tatgctaccc actatagtta ataaacaaaa       600
     agcaaactgg tctctattct atctcatgca ctcaggcaca acttttccag atttaagggg       660
     gaaaaaaaac cctgtcttta cacctacaat cccagggcga gctcactctc tggcaccaag       720
     ctccgtgggg tgatttttct tctagaagag tacaggagga caggcaagga gtgggaggca       780
     gggagtccag ttcagggaca gggattccgg gatgaaaagt gaagggagag ggacagggac       840
     cttgccgagg gtttctccct ggtttctcag acagctcctg ggccaagact cagggagaca       900
     ctgagacaga acgcttggca caagagtagc ggggtcaggg cgaagtccca gggcctcaag       960
     cgtggctctc agggtctcag gccccacagg cggtgtatgg attggggagg ccccgcgttg      1020
     gggattctct cctccttctc ctaacctgtg tcgggtcctt cttcctggat actcaccggg      1080
     cggccccagt tctcactccc attaggtgac aggtttttag agaagccaat cagcgtcgcc      1140
     gcggtcctgg ttctaaagtc ctcgctcacc cacccggact cattctcccc agacgccaag      1200
     gatggtggtc atggcacccc gaaccctctt cctgctactc tcgggggccc tgaccctgac      1260
     cgagacctgg gcgggtgagt gcggggtcag gagggaaacg gcccctgcgc ggaggaggga      1320
     ggggccggcc cggcgggggc gcaggacccg gcagccgcgc cgggaggagg gtcgggcggg      1380
     tctcaacctc tcctcgcccc caggctccca ctccatgagg tatttcagcg ccgccgtgtc      1440
     ccggcccggc cgcggggagc cccgcttcat cgccatgggc tacgtggacg acacgcagtt      1500
     cgtgcggttc gacagcgact cggcgtgtcc gaggatggag ccgcgggcgc cgtgggtgga      1560
     gcaggagggg ccagagtatt gggaagagga gacacggaac accaaggccc acgcacagac      1620
     tgacagaatg aacctgcaga ccctgcgcgg ctactacaac cagagcgagg ccagtgagta      1680
     accccggccc agggcgcaga tcacgacccc ccacctccat gccccacgga cgccccgggt      1740
     actcccgagt ctccgggtct gggatccacc ccgaggccgc gggacccgcc cagaccctct      1800
     acctgggaga accccaggcg cctttaccaa aatccctgcg ggtgggtccg ggcgagggcg      1860
     aggctcggtg ggcggggctg accgaagggg tggggccagg ttctcatacc ctccagtgga      1920
     tgattggctg cgacctgggg tccgacggac gcctcctccg cgggtatgaa cagtatgcct      1980
     acgatggcaa ggattacctc gccctgaacg aggacctgcg ctcctggacc gcagcggaca      2040
     ctgcggctca gatctccaag cgcaagtgtg aggcggccaa tgtggctgaa caaaggagag      2100
     cctacctgga gggcacgtgc gtggagtggc tccacagata cctggagaac gggaaggaga      2160
     tgctgcagcg cgcgggtacc aggggcagtg gggcgcctcc ctgatctcct gtagacttcc      2220
     cagcctggcc tagcacaagg agaggaggaa aatgggacca acaccagaat atcgccctcc      2280
     ctctggtcct gagggagagg aatcctcctg ggtttccaga tcctgtacca gagagtgatt      2340
     ctgagggccc gtcctgctct ctgggacaat taagggatga agtctctgag ggagtggagg      2400
     ggaagacaat ccctggagga ctgatcaggg gttccctttg accccacagc agccttggca      2460
     ccaggacttt tcccctcagg ccttgttctc tgcctcacac tcaatgtgtg tgggagtctg      2520
     actccagctc ctctgagtcc cttggcctcc actcaggtca gaaccagagg tccctgctcc      2580
     cccgctcaga gactagaact ttccaaggaa taggagatta tcccaggtgc ccgtgtccag      2640
     gctggtgtct gggttctgtg ctcccttccc caccccaggt atctggttca ttcttaggat      2700
     ggtcacatcc aggtgctgct ggagtgtccc atgagagatg caaagtgctt gagttttctg      2760
     actcttcctt tcagaccccc ccaagacaca cgtgacccac caccctgtct ttgactatga      2820
     ggccaccctg aggtgctggg ccctgggctt ctaccctgcg gagatcatac tgacctggca      2880
     gcgggatggg gaggaccaga cccaggacgt ggagctcgtg gagaccaggc ctgcagggga      2940
     tggaaccttc cagaagtggg cagctgtggt ggtgccttct ggagaggagc agagatacac      3000
     gtgccatgtg cagcatgagg ggctgccgga gcccctcatg ctgagatgga gtaaggaggg      3060
     agatggaggc atcatgtctg ttagggaaag caggagcctc tctgaagacc tttaacaggg      3120
     tcggtggtga ggcctggggg tcagagaccc tcaccttcac ctcctttccc agagcagtct      3180
     tccctgccca ccatccccat catgggtatc gttgctggtc tggttgtcct tgcagctgta      3240
     gtcactggag ctgcggtcgc tgctgtgctg tggaggaaga agagctcagg taaggaaggg      3300
     gtgacaagtg gggtctgagt tttcttgtcc cactgggggt ttcaagcccc aggtagaagt      3360
     gcgccctgcc tggttactgg gaagcaccat ccacactcat gggcctaccc agcctgggcc      3420
     ctgtgtgcca gcaccttctc ttttgtaaag cacctgtgac aatgaaggac agatttatca      3480
     ccttgatgat tgtagtgatg gggacctgat cctagtaatc acaggtcagg ggaaggtccc      3540
     tggctaagga cagaccttag gagggcagtt ggtcgaggac ccacatctgc tttccttgtt      3600
     tttcctgatc ccgccctgag tctgcagtca cacatttctg gaaacttctc gagggtccaa      3660
     gactaggagg ttcctctagg acctcatggc cctgccacct ttctggcctc tcacaggacg      3720
     ttttcttccc acagattgaa aaggagggag ctactctcag gctgcaagta agtatgaagg      3780
     aggctgatcc ctgagatcct tgggatcttg tgtttgggag cccatggggg agctcaccca      3840
     ccccacaatt cctcctctgg ccacatctcc tgtggtctct gaccaggtgc tgtttttgtt      3900
     ctactctagg cagtgacagt gcccagggct ctaatgtgtc tctcacggct tgtaaatgtg      3960
     acaccccggg gggcctgatg tgtgtgggtt gttgagggaa acagtggaca tagctgtgct      4020
     atgaggtttc tttgacttga atgtattgag catgtgatgg gctgtttaaa gtgtcacccc      4080
     tcactgtgac tgatatgaat ttgttcatga atatttttct gtagtgtgaa acagctgccc      4140
     tgtgtgggac tgagtggcaa gatttgttca tgcctccctt tgtgacttca agaaccctga      4200
     cttctctttc tgcagagacc agcccacccc tgtgcccacc atgaccctct tcctcatgct      4260
     gaactgcatt ccttccccaa tcacctttcc tgttccagaa aaggggctgg gatgtctccg      4320
     tctctgtctc aaatttgtgg tgcactgagc tataacttac ttctgtatta aaattagaat      4380
     ctgagtataa atttagtttt tcaaattatt tccaagagag attgatgggt taattaaagg      4440
     agaagattcc tgaaatttga gagacaaaat aaatggaaga catgagaact ttccacagta      4500
     cacgtgtttc ttgtgctgat ttgttgcagg agaggagagt agatggggct gcgcccagtg      4560
     ggtgctcagg ccaccatgaa ctttatgtgg tcactgctca gctgggtcat ctttgctgct      4620
     ccattgtcct tggcccttca gtagaacctt gtcccaccag gacctgtgat cacatagact      4680
     tggatatcac ctagggtggt ccctacactt agaagttcct gtgttatcag aagaaaaatt      4740
     ttcagacccc tacacctctt cccctccttc caggtctctt tcaattgtat tttccatctt      4800
     tttttttttt tttttttttt tttttttttt ttttttgaga tggagtctca ctcaggctgg      4860
     agtgcagtgg tgcaatctcg actcattgca acctccacct cccgggttca agcaatcctc      4920
     ctgtcttagc ctccctagta actgggagta caggcacatg ccacgatacc cagctaattt      4980
     tttgtatttt tagtaaagac gggatttcac catgttagcc aggatggtct tgatctcctg      5040
     accttgtgat ctgcccgcct ctgcctccca aagtgctggg attacaggtg taagccacca      5100
     tgcctggctt ccccaacctt cttaaaggaa gcagattctg aaacttcccg agaggagagg      5160
     tcccagagtt tttcattgta gtttactttc tgttggaact cctcttctgc tctctctcct      5220
     actcttcttc ctgccctgag ttgtagtaat cctattgctg gctccaaacc aaactcatgg      5280
     atttgtaaag cagagtctaa tttagattca tatgtggttg gataattgga gccataagcc      5340
     ttgggttatc tttcctcaag agacaaatat ggttgtgtgc tgcagtgtgc aggaggattg      5400
     gtgtgggagg aggagggagg gagggaggac acaaaagcag ccctggtgag aaaagcactg      5460
     gtgcatttat atccacatga gataatattg ttccacagcg gctacaaaat gacatttggc      5520
     ctgagtctac attaataaag atattgcctt tagaataggg gggcgcacta cagtaatcat      5580
     ccattcaagt                                                             5590
//


spacer
spacer