spacer

EBI Dbfetch

ID   AY645763; SV 1; linear; genomic DNA; STD; HUM; 5591 BP.
XX
AC   AY645763;
XX
DT   19-JUL-2004 (Rel. 80, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens isolate Afr-Am022 MHC class Ib antigen (HLA-G) gene,
DE   HLA-G*010106 allele, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-5591
RX   DOI; 10.1007/s00251-005-0076-z.
RX   PUBMED; 16570139.
RA   Pyo C.W., Williams L.M., Moore Y., Hyodo H., Li S.S., Zhao L.P.,
RA   Sageshima N., Ishitani A., Geraghty D.E.;
RT   "HLA-E, HLA-F, and HLA-G polymorphism: genomic sequence defines haplotype
RT   structure and variation spanning the nonclassical class I genes";
RL   Immunogenetics 58(4):241-251(2006).
XX
RN   [2]
RP   1-5591
RA   Pyo C.-W., Ishitani A., Moore Y.F., Geraghty D.E.;
RT   ;
RL   Submitted (04-JUN-2004) to the INSDC.
RL   Clinical Division, Fred Hutchinson Cancer Research Center, 1100 Fairview
RL   Ave. N., D4-100, Seattle, WA 98109-1024, USA
XX
DR   MD5; c7db7e7d17100fe7b75bc1c0039cfcd0.
DR   Ensembl-Gn; ENSG00000204632; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206506; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230413; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233095; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235346; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235680; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237216; homo_sapiens.
DR   Ensembl-Tr; ENST00000360323; homo_sapiens.
DR   Ensembl-Tr; ENST00000376828; homo_sapiens.
DR   Ensembl-Tr; ENST00000383621; homo_sapiens.
DR   Ensembl-Tr; ENST00000400665; homo_sapiens.
DR   Ensembl-Tr; ENST00000400682; homo_sapiens.
DR   Ensembl-Tr; ENST00000420559; homo_sapiens.
DR   Ensembl-Tr; ENST00000422371; homo_sapiens.
DR   Ensembl-Tr; ENST00000423011; homo_sapiens.
DR   Ensembl-Tr; ENST00000423373; homo_sapiens.
DR   Ensembl-Tr; ENST00000428701; homo_sapiens.
DR   Ensembl-Tr; ENST00000428952; homo_sapiens.
DR   Ensembl-Tr; ENST00000434881; homo_sapiens.
DR   Ensembl-Tr; ENST00000444098; homo_sapiens.
DR   Ensembl-Tr; ENST00000449127; homo_sapiens.
DR   Ensembl-Tr; ENST00000450984; homo_sapiens.
DR   Ensembl-Tr; ENST00000546545; homo_sapiens.
DR   Ensembl-Tr; ENST00000546634; homo_sapiens.
DR   Ensembl-Tr; ENST00000547241; homo_sapiens.
DR   Ensembl-Tr; ENST00000547931; homo_sapiens.
DR   Ensembl-Tr; ENST00000550897; homo_sapiens.
DR   Ensembl-Tr; ENST00000553052; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5591
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="Afr-Am022"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1203..>3740
FT                   /gene="HLA-G"
FT                   /allele="HLA-G*010106"
FT   mRNA            join(<1203..1275,1405..1674,1901..2176,2776..3051,
FT                   3174..3290,3736..>3740)
FT                   /gene="HLA-G"
FT                   /allele="HLA-G*010106"
FT                   /product="MHC class Ib antigen"
FT   CDS             join(1203..1275,1405..1674,1901..2176,2776..3051,
FT                   3174..3290,3736..3740)
FT                   /codon_start=1
FT                   /gene="HLA-G"
FT                   /allele="HLA-G*010106"
FT                   /product="MHC class Ib antigen"
FT                   /db_xref="GOA:Q6DU14"
FT                   /db_xref="IMGT/HLA:G*01:01:06"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DU14"
FT                   /protein_id="AAT73246.1"
FT                   /translation="MVVMAPRTLFLLLSGALTLTETWAGSHSMRYFSAAVSRPGRGEPR
FT                   FIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQT
FT                   LRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTA
FT                   AQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYE
FT                   ATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD"
XX
SQ   Sequence 5591 BP; 1234 A; 1440 C; 1535 G; 1382 T; 0 other;
     gaggaaagaa ttccaaagca gcggaactct taggtttaaa cacattgttt tatagatttt        60
     aatgcatcca tccacagagc ctcgctgggt gttctttgca gttggccttt aatatcttat       120
     gtgggtctgc ctagaaacta attgtttttt atgttaatca ggtttaaaaa atactaagta       180
     ttcctaaaaa atatacactc cactcacatg tggatacttc ctaaaaacag gcagtgcgtg       240
     agcactagtg aggggcattg tgactgcact gaacacttac aactgtgagg tgaataaagt       300
     ttgtgctggc tcctggttgc aacatatagt aacatagtgt ggtactttgt cttgaggaga       360
     tgtcctggac tcacacggaa acttagggct acggaatgaa ggtaaattta aaataaaaca       420
     agcgggagtc acagatacac tgtctgggaa agtgaaactt aagagctttg tgagtcctgt       480
     tgtaatgctt ttagatgcat ttatatacca acaggccaaa gtcacatttt ttaccgatta       540
     gattcctgat cattcagggg ttaccaaggt tatgctaccc actatagtta ataaacaaaa       600
     agcaaactgg tctctattct atctcatgca ctcaggcaca acttttccag atttaagggg       660
     ggaaaaaaaa ccctgtcttt acacctacaa tcccagggcg agctcactct ctggcaacaa       720
     gctccctggg gtgatttttc ttctagaaga gtacaggagg acaggcaagg agtgggaggc       780
     agggagtcca gttcagggac agggattccg ggatgaaaag tgaagggaga gggccaggga       840
     ccttgccgag ggtttctccc tggtttctca gacagctcct gggccaagac tcagggagac       900
     actgagacag aacgcttggc acaagagtag cggggtcagg gcgaagtccc agggcctcaa       960
     gcgtggctct cagggtctca ggccccacag gcggtgtatg ggttggggag gccccgcgtt      1020
     ggggattctc tcctccttct cctaacctgt gtcgggtcct tcttcctgga tactcaccgg      1080
     gcggccccag ttctcactcc cattaggtga caggttttta gagaagccaa tcagcgtcgc      1140
     cgcggttctg gttctaaagt cctcgctcac ccacccggac tcattctccc cagacgccaa      1200
     ggatggtggt catggcgccc cgaaccctct tcctgctgct ctcgggggcc ctgaccctga      1260
     ccgagacctg ggcgggtgag tgcggggtca ggagggaaac ggcccctgcg cggaggaggg      1320
     aggggcccgc ctggcggggg cgcaggaccc ggcagccgcg ccgggaggag ggtcgggcgg      1380
     gtctcaaccc ctcctcgccc ccaggctccc actccatgag gtatttcagc gccgccgtgt      1440
     cccggcccgg ccgcggggag ccccgcttca tcgccatggg ctacgtggac gacacgcagt      1500
     tcgtgcggtt cgacagcgac tcggcgtgtc cgaggatgga gccgcgggcg ccgtgggtgg      1560
     agcaggaggg gccggagtat tgggaagagg agacacggaa caccaaggcc cacgcacaga      1620
     ctgacagaat gaacctgcag accctgcgcg gctactacaa ccagagcgag gccagtgagt      1680
     aacccctgcc cagggcgcag atcacgacac ccacctccat gccccacgga cggcccgggt      1740
     actcccgagt ctccgggtct gggatccacc ccgaggccgc gggacccgcc cagaccctct      1800
     acctgggaga accccaaggc gcctttacca aaatccctgc gggtgtgtcc gggcgagggc      1860
     gaggctcggt gggcggggct gaccgagggg gtggggccag gttctcacac cctccagtgg      1920
     atgattggct gcgacctggg gtccgacgga cgcctcctcc gcgggtatga acagtatgcc      1980
     tacgatggca aggattacct cgccctgaac gaggacctgc gctcctggac cgcagcggac      2040
     actgcggctc agatctccaa gcgcaagtgt gaggcggcca atgtggctga acaaaggaga      2100
     gcctacctgg agggcacgtg cgtggagtgg ctccacagat acctggagaa cgggaaggag      2160
     atgctgcagc gcgcgggtac caggggcagt ggggcgcctc cctgatctcc tgtagacctc      2220
     ccagcctggc ctagcacaag gagaggagga aaatgtgacc aacactagaa tatcgccctc      2280
     cctctggtcc tgagggagag gaatcctcct gggtttccag atcctgtacc agagagtgat      2340
     tctgagggtc cgtcctgctc tctgggacaa ttaagggatg aagtctctga gggagtggag      2400
     gggaagacaa tccctggaag actgatcagg ggttcccttt gaccccacag cagccttggc      2460
     accaggactt ttcccctcag gccttgttct ctgcctcaca ctcaatgtgt gtgggagtct      2520
     gactccagct cctctgagtc ccttggcctc cactcaggtc agaaccggag gtccctgctc      2580
     ccccgctcag agactagaac tttccaagga ataggagatt atcccaggtg cccgtgtcca      2640
     ggctggtgtc tgggttctgt gctcccttcc ccaccccagg tatctggttc attcttagga      2700
     tggtcacatc caggtgctgc tggagtgtcc catgacagat gcaaagtgct tgagttttct      2760
     gactcttcct ttcagacccc cccaagacac atgtgaccca ccaccctgtc tttgactatg      2820
     aggccaccct gaggtgctgg gccctgggct tctaccctgc ggagatcata ctgacctggc      2880
     agcgggatgg ggaggaccag acccaggacg tggagctcgt ggagaccagg cctgcagggg      2940
     atggaacctt ccagaagtgg gcagctgtgg tggtgccttc tggagaggag cagagataca      3000
     cgtgccatgt gcagcatgag gggctgccgg agcccctcat gctgagatgg agtaaggagg      3060
     gagatggagg catcatgtct gttagggaaa gcaggagcct ctctgaagac ctttaacagg      3120
     gtcggtggtg agggctgggg gtcagagacc ctcaccttca cctcctttcc cagagcagtc      3180
     ttccctgccc accatcccca tcatgggtat cgttgctggc ctggttgtcc ttgcagctgt      3240
     agtcactgga gctgcggtcg ctgctgtgct gtggaggaag aagagctcag gtaaggaagg      3300
     ggtgacaagt ggggtctgag ttttcttgtc ccactggggg tttcaagccc caggtagaag      3360
     tgtgccctgc ctggttactg ggaagcacca tccacactca tgggcctacc cagcctgggc      3420
     cctgtgtgcc agcaccttct cttttgtaaa gcacctgtga caatgaagga cagatttatt      3480
     accttgatga ttgtagtgat ggggacctga tcccagtaat cacaggtcag gagaaggtcc      3540
     ctggctaagg acagacctta ggagggcagt tggtcgagga cccacatctg ctttccttgt      3600
     ttttcctgat cccgccctgg gtctgcagtc acacatttct ggaaacttct cgagggtcca      3660
     agactaggag gttcctctag gacctcatgg ccctgccacc tttctggcct ctcacaggac      3720
     attttcttcc cacagattga aaaggaggga gctactctca ggctgcaagt aagtatgaag      3780
     gaggctgatc cctgagatcc ttgggatctt gtgtttggga gcccatgggg gagctcaccc      3840
     accccacaat tcctcctctg gccacatctc ctgtggtctc tgaccaggtg ctgtttttgt      3900
     tctactctag gcagtgacag tgcccagggc tctaatgtgt ctctcacggc ttgtaaatgt      3960
     gacaccccgg ggggcctgat gtgtgtgggt tgttgagggg aacagtggac atagctgtgc      4020
     tatgaggttt ctttgacttc aatgtattga gcatgtgatg ggctgtttaa agtgtcaccc      4080
     ctcactgtga ctgatatgaa tttgttcatg aatatttttc tgtagtgtga aacagctgcc      4140
     ctgtgtggga ctgagtggca agatttgttc atgcctccct ttgtgacttc aagaaccctg      4200
     acttctcttt ctgcagagac cagcccaccc ctgtgtccac catgaccctc ttcctcatgc      4260
     tgaactgcat tccttcccca atcacctttc ctgttccaga aaaggggctg ggatgtctcc      4320
     gtctctgtct caaatttgtg gtgcactgag ctataactta cttctgtatt aaaattagaa      4380
     tctgagtata aatttacttt ttcaaattat ttccaagaga gattgatggg ttaattaaag      4440
     gagaagattc ctgaaatttg agagacaaaa taaatggaag acatgagaac tttccacagt      4500
     acacgtgttt cttgtgctga tttgttgcag gagaggagag tagatggggc tgcgcccagt      4560
     gggtgctcag gccaccatga actttatgtg gtcactgctc agctgggtca tctttgctgc      4620
     tctattgtcc ttggcccttc agtagaacct tgtcccacca ggacctgtga tcacatagac      4680
     ttggatatca cctagggtgg tccctacacg tagaagttcc tgtgttatca gaagaaaaat      4740
     tttcagaccc ctacacctct tcccctcctt ccaggtctct ttcaattgta ttttccatct      4800
     tttttttttt tttttttttt tttttttttt tttttttgag atggagtctc actcaggctg      4860
     gagtgcagtg gtgcaatctc gactcattgc aacctccacc tcccgggttc aagcaattct      4920
     cctgtctcag cctccctagt aactgggagt acaggcacat gccacaatac ccagctaatt      4980
     ttttgtattt ttagtaaaga cgggatttca ccatgttagc caggatggtc ttgatctcct      5040
     gaccttgtga tctgcccgcc tctgcctccc aaagtgctgg gattacaggt gtaagccacc      5100
     atgcctggct tccccaacct tcttaaagga agcagattct gaaacttccc gagaggagag      5160
     gtcccagagt ttttcattgt agtttacttt ctgttggaac tcctcttctg ctctctctcc      5220
     tactcttctt cctgccctga gttgtagtaa tcctattgct ggctccaaac caaactcatg      5280
     gatttgtaaa gcagagtcta atttagattc atatgtggtt ggataattgg agccataagc      5340
     cttgggttat ctttcctgaa gagacaaata tggttgtgtg ctgcagtgtg caggaggatt      5400
     ggtgtgggag gaggagggag ggagggagga cacaaaagca gccctggtga gaaaagcact      5460
     ggtgcattta tatccacatg agataatatt gttccacagc ggctacaaaa tgacatttgg      5520
     cctgagtcta cattaataaa gatattgcct ttagaatagg ggggcgcact acagtaatca      5580
     tccattcaag t                                                           5591
//


spacer
spacer