spacer

EBI Dbfetch

ID   AY645740; SV 1; linear; genomic DNA; STD; HUM; 8325 BP.
XX
AC   AY645740;
XX
DT   19-JUL-2004 (Rel. 80, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens isolate Sea-Cau-1 MHC class Ib antigen (HLA-E) gene,
DE   HLA-E*010302 allele, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-8325
RX   DOI; 10.1007/s00251-005-0076-z.
RX   PUBMED; 16570139.
RA   Pyo C.W., Williams L.M., Moore Y., Hyodo H., Li S.S., Zhao L.P.,
RA   Sageshima N., Ishitani A., Geraghty D.E.;
RT   "HLA-E, HLA-F, and HLA-G polymorphism: genomic sequence defines haplotype
RT   structure and variation spanning the nonclassical class I genes";
RL   Immunogenetics 58(4):241-251(2006).
XX
RN   [2]
RP   1-8325
RA   Pyo C.-W., Ishitani A., Moore Y.F., Geraghty D.E.;
RT   ;
RL   Submitted (04-JUN-2004) to the INSDC.
RL   Clinical Division, Fred Hutchinson Cancer Research Center, 1100 Fairview
RL   Ave. N., D4-100, Seattle, WA 98109-1024, USA
XX
DR   MD5; 678a2945c718df9e09cd1e237685d566.
DR   Ensembl-Gn; ENSG00000204592; homo_sapiens.
DR   Ensembl-Gn; ENSG00000225201; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236632; homo_sapiens.
DR   Ensembl-Tr; ENST00000376630; homo_sapiens.
DR   Ensembl-Tr; ENST00000425603; homo_sapiens.
DR   Ensembl-Tr; ENST00000444683; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..8325
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="Sea-Cau-1"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <2813..>5862
FT                   /gene="HLA-E"
FT                   /allele="HLA-E*010302"
FT   mRNA            join(<2813..2876,3007..3276,3521..3796,4418..4693,
FT                   4818..4934,5685..5717,5822..>5862)
FT                   /gene="HLA-E"
FT                   /allele="HLA-E*010302"
FT                   /product="MHC class Ib antigen"
FT   CDS             join(2813..2876,3007..3276,3521..3796,4418..4693,
FT                   4818..4934,5685..5717,5822..5862)
FT                   /codon_start=1
FT                   /gene="HLA-E"
FT                   /allele="HLA-E*010302"
FT                   /product="MHC class Ib antigen"
FT                   /note="antigen presentation"
FT                   /db_xref="GOA:Q6DU44"
FT                   /db_xref="HGNC:HGNC:4962"
FT                   /db_xref="IMGT/HLA:E*01:03:02:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DU44"
FT                   /protein_id="AAT73223.1"
FT                   /translation="MVDGTLLLLLSEALALTQTWAGSHSLKYFHTSVSRPGRGEPRFIS
FT                   VGYVDDTQFVRFDNDAASPRMVPRAPWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRG
FT                   YYNQSEAGSHTLQWMHGCELGPDGRFLRGYEQFAYDGKDYLTLNEDLRSWTAVDTAAQI
FT                   SEQKSNDASEAEHQRAYLEDTCVEWLHKYLEKGKETLLHLEPPKTHVTHHPISDHEATL
FT                   RCWALGFYPAEITLTWQQDGEGHTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCH
FT                   VQHEGLPEPVTLRWKPASQPTIPIVGIIAGLVLLGSVVSGAVVAAVIWRKKSSGGKGGS
FT                   YSKAEWSDSAQGSESHSL"
XX
SQ   Sequence 8325 BP; 1984 A; 2077 C; 2109 G; 2155 T; 0 other;
     gatgctgaag gagatgagtg ggcttcgcag tgaatgtggc agttcaaaaa ataccttcat        60
     tgtttggacc tgcatattta gctgttttgg aacacagttg attccttgag tttcaaatat       120
     agactgctac agtcacatca caatattcag cggtgaaatc ttgtttgtta ctgtcattcc       180
     cattcctttt cgtttagaat cagaataaag ttgtatttca aatatctaaa aacaaaaaat       240
     ccttcctttt tcaactcaat atttgtgtaa ggctagattt tttaacatat acacttcaat       300
     caaagtaaga aaatggctgg gatgcagctg gaggccataa tcctaagtga attaatgcag       360
     gaacagaaaa ccaaatactg catcttctca cttataattg ggagctaaac actgagcaca       420
     catagacata aacatgtgta taacagacac tgtagagact agagtggaga gggtggggac       480
     gtgggttgaa aaactacctg tgggtactat gttcactacc tgagtgacag gatccatacc       540
     ccaaacctca gcatcagaca acatacccat gtaacaaacc ggcacatgta acccctgtat       600
     ctattttttt ctggtttttt tttttttttt ttgagacaat ttcactcttg ttgctcaggc       660
     tggagcgcaa tggcgtgatc tcggctcatc gcaacctctg cctcccgggt tcaagcgatt       720
     ctcctgcctc agcctcctga gtagtgggat tacaggtatg cgccaccacc tccagctaat       780
     tttgtatttt tagtagacat ggggtttctc catattgata aggctggtct cgaactcccg       840
     actgggatta caggcgtgag ccaccgcgcc tggccacccc ctgtatctaa aataaaagtt       900
     aaaaatttaa aaataagtac ataagagaat gtatgctatg agccaagaat gatgcttgca       960
     aaattttgca acaacaacac ttatgaaaat gaaaaataat cactcttctt gttaccaaaa      1020
     atcttggtag ctgcagaagg tgggatcttt cctcactggg agtcgcagag ccaatacatg      1080
     aaaccaaaag tgagccttaa gcagagcaag ctttatttcc tgcacaggac ttgtaaagag      1140
     gagagcagct ctgccaagtc aacttctcca ctagtgaggc ggctagtgag gggtgagggg      1200
     gctaaaatgt aggattgctc taatgaaggg gttgggcatt aaaagtgagg gggaggaata      1260
     ttcatatgtt ttatgggaac aggcagtgaa cttctccaaa ctggtaatac cgctttcctt      1320
     ttggtccttt taggacttct tctactcatc gtcatggaga tcgtcaactg tcatggcatg      1380
     gatgggagcg caatttagcc tggaaacggg attacaatga agcgtgaggt ctttttgaag      1440
     tcatttggcc ggctctcttg gttgtaacga gtctcagctg gtttgactac aaaggcaact      1500
     tcttgaagca gatcctgttt ttttgttttt gtttttgttt tttgtttctt gttttttccc      1560
     cctagacatc tcactctgtc gcccaggctg gagtgcagtg gtgtgatctc ggctcactgc      1620
     aaccaccacc tctcgggttc aagcaattct cctatctcag cctccagagt tgctggaatt      1680
     acaggcgcgc accaccacac ccggctaatt tttgtattgt tagtagagac agggtttcat      1740
     catgttggcc aggttagtct tgaactcctg acctcgtgat ctgcctgcct cggcctacca      1800
     aaatgctgcg attacaggcg tgagccaccg ttcccggcct atacgttgtt tattttggaa      1860
     aaattaaaaa ttaagttttt tttcattaaa gatatgttat ttccgatcaa gagatcaaga      1920
     ccatcctggc caacatggtg aaaccccgtc tctactaaaa acacaaaaat tagctgggtg      1980
     tggtggcaca cgcctgtagt tccagttact ggggaggctg aggcaggaga atcgcttgaa      2040
     cccgggagaa ggaggttgca gtgagccgag atcatgccac tgcactccag cctggggaca      2100
     gagcaagact ctgactcaaa aaaaaaaaaa agttgtttct attaacatgt aatgggttat      2160
     taatattctc ttaaatgaat taatattttt aatattttgt tttaatatct tttaatttat      2220
     atatgataaa aattgataca atccacagaa acaaaattta tttgggtcct cactaatttc      2280
     ttttttcttg ttgcccaggc tggagggcaa tggcacgatc ttggctcacc gcaacctcct      2340
     cctcctgggt tcaagtgatt ctcctgcctc agcctcccaa gtagccagga ttacagccat      2400
     gcgccaccac gccggctaat tttttggact tttagtagag acagggtttc tccatattgg      2460
     tcgggctggt ctcgaactcc caacctcagg tgatcagccc gccttggcct cccaaagtgc      2520
     tgagattaca ggcgtgagcc accgcgccca gccaggacta atttctaaga gtgtgcagag      2580
     ataccgaaac ctaaaagttt aagaactgct gattgctggg aaactctgca gtttcccgtt      2640
     cctctcgtaa cctggtcatg tgtccttctt cctggatact catgacgcag actcagttct      2700
     cattcccaat gggtgtcggg tttctagaga agccaatcag cgtcgccacg actcccgact      2760
     ataaagtccc catccggact caagaagttc tcaggactca gaggctggga tcatggtaga      2820
     tggaaccctc cttttactcc tctcggaggc cctggccctt acccagacct gggcgggtga      2880
     gtgcggggtc gggatggaaa cggcctctac cgggagtaga gaggggccgg cccggcgggg      2940
     gcgaaggact cggggagccg cgccgggagg agggtcgggc cgatctcagc ccctcctcgc      3000
     ccccaggctc ccactccttg aagtatttcc acacttccgt gtcccggccc ggccgcgggg      3060
     agccccgctt catctctgtg ggctacgtgg acgacaccca gttcgtgcgc ttcgacaacg      3120
     acgccgcgag tccgaggatg gtgccgcggg cgccgtggat ggagcaggag gggtcagagt      3180
     attgggaccg ggagacacgg agcgccaggg acaccgcaca gattttccga gtgaatctgc      3240
     ggacgctgcg cggctactac aatcagagcg aggccggtga gtgaccccgg ccaggggagc      3300
     aggtcacgac ccctccccat cccccacgga cggcgcgggt cccctcgaat cttcgggtcc      3360
     cagattcacc ccaaggctgc ggaacccgcc cagaccctag accggggaga gtctcaggcg      3420
     cctttacccg gttctttttc agtttaggcc aaaatgccca cagggtggtg gcgacggggg      3480
     cggggcttgg tgggcgggac tgactaaggg gcggggccag ggtctcacac cctgcagtgg      3540
     atgcatggct gcgagctggg gcccgacggg cgcttcctcc gcgggtatga acagttcgcc      3600
     tacgacggca aggattatct caccctgaat gaggacctgc gctcctggac cgcggtggac      3660
     acggcggctc agatctccga gcaaaagtca aatgatgcct ctgaggcgga gcaccagaga      3720
     gcctacctgg aagacacatg cgtggagtgg ctccacaaat acctggagaa ggggaaggag      3780
     acgctgcttc acctgggtaa gagggtccac agggctactc tcccatctcc ttcttgggct      3840
     aggactgtgc ccacagctga cagacctcaa acagtagaag aaacagggat ggaggccaga      3900
     ataccactcc tcccttggat caggagaggg agctgtcacc tgaggtacag gagatcctat      3960
     accacagagt gactctctta aagggccaga cctctctcag gggcaattaa ggaatctagt      4020
     ctcgctggag attccatcct tcagatgaac tgatgagcag ttctctttga ctcccagtat      4080
     taggaatcac gggggagttt ctctcgtgcc tgattctcag ccccacacca agagtttttg      4140
     gaggtctgac tccagctttt ctcagtcact cagcatccac acaggccagg accagaaatc      4200
     ccttttcacc ttctaccctg ggctagctca tcccgattct agaactttcc aaggaataag      4260
     aggctatccc agatccctaa gtccaggctg gtgtcaaggt tttgtcctct tctcctacta      4320
     taattgtcct cttccttctc aggatggtca catgggtgct gctggagtgt cccatgagag      4380
     atacaaagtg cctgaatttt ctgactcttc ccctcagagc ccccaaagac acacgtgact      4440
     caccacccca tctctgacca tgaggccacc ctgaggtgct gggccctggg cttctaccct      4500
     gcggagatca cactgacctg gcagcaggat ggggagggcc atacccagga cacggagctc      4560
     gtggagacca ggcctgcagg ggatggaacc ttccagaagt gggcagctgt ggtggtgcct      4620
     tctggagagg agcagagata cacgtgccat gtgcagcatg aggggctacc cgagcccgtc      4680
     accctgagat ggagtaagga gggggatggg aggtcatgtc tcttctcagg gaaagcggga      4740
     gcccttctgg agcccttccg cagggtcagg gctgaggcct gggggtcagg gccccttacg      4800
     ttcccctctt ttcccagagc cggcttccca gcccaccatc cccatcgtgg gcatcattgc      4860
     tggcctggtt ctccttggat ctgtggtctc tggagctgtg gttgctgctg tgatatggag      4920
     gaagaagagc tcaggtgggg aagggagaag ggtggggtct gagttttctt gtcccactgg      4980
     gtgtttcaag ccctaggtaa aagtgtgtcc tgcctcgtta ctgggaagca ccatccacac      5040
     acacgagcct acccagcctg gggccctgtg tgccagcacc tactcttttt ttttgagacg      5100
     gagtcttggc tctgtcaccc aggctggagt gcaatggcgt ggtttcagct cactgcaacc      5160
     tccgcctccc aggttcaagc aattctcctg cctcagcctc cctagtagct gggactacac      5220
     atgcgtgcca ccacacctgg ctaatttttt tttttgtatt tttagtggag atggggtttc      5280
     actatgttgg ccaggctggt ctcgaactcc tgactttgtg atctgcctgc ctcggcctcc      5340
     caaagtgctg ggattacagt cgtgagccac cgcacccagc cgcacctact cttttgtaaa      5400
     gcacctgtga caatgaagga cagatttatc accttgacga ttgtggtgat ggggacctga      5460
     tcccagcagt cacaggtcac aggggaaggt ccctgctgaa gacagacctc agaagggcag      5520
     ttgatccagg acccacacct gctttcttca cgtttcctga tcctgccctg ggtctgcagt      5580
     cacagttcag gaaacttctc tgggatccaa aactaggagg ttcctctagg accttatggc      5640
     cctgcctcct ccctggcccc tcacaggaca ttttcttcca acaggtggaa aaggagggag      5700
     ctactctaag gctgagtgta agtgcggggc gggagcgtgg aggagctcgc ccaccctata      5760
     attcctcctg caccacatct cctgtgggct ctgaccaggt cttgtttttg ttctacccca      5820
     gggagcgaca gtgcccaggg gtctgagtct cacagcttgt aaaggtgaga ttctgggggt      5880
     ctgaagtggg tggagggtgg ggcagagggg acaggactgg gttgtgggga ttttttgatt      5940
     cagaattttt gagtgtgtgg tgggctgttc agagtgtcat cacttaccgt gactgacctg      6000
     aatttgttca tgactatttt cttctgtagc ctgagacagc tgccttgtgt gcgactgaga      6060
     tgcacagctg ccttgtgtgc gactgagatg caggatttcc tcacgcctcc cctatgtgtc      6120
     ttaggggact ctggcttctc tttttgcaag ggcctctgaa tctgtctgtg tccctgttag      6180
     cacaatgtga ggaggtagag aaacagtcca cctctgtgtc taccatgacc cccttcctca      6240
     cactgacctg tgttccttcc ctgttctctt ttctattaaa aataagaacc tgggcagagt      6300
     gcggcagctc atgcctgtaa tcccagcact tagggaggcc gaggagggca gatcacgagg      6360
     tcaggagatc gaaaccatcc tggctaacac ggtgaaaccc cgtctctact aaaaaataca      6420
     aaaaattagc tgggcgcaga ggcacgggcc tgtagtccca gctactcagg aggcggaggc      6480
     aggagaatgg cgtcaacccg ggaggcggag gttgcagtga gccaggattg tgcgactgca      6540
     ctccagcctg ggtgacaggg tgaaacgcca tctcaaaaaa taaaaattga aaaataaaaa      6600
     aagaacctgg atctcaattt aatttttcat attcttgcaa tgaaatggac ttgaggaagc      6660
     taagatcata gctagaaata cagataattc cacagcacat ctctagcaaa tttagcctat      6720
     tcctattctc tagcctattc cttaccacct gtaatcttga ccatatacct tggagttgaa      6780
     tattgttttc atactgctgt ggtttgaatg ttccctccaa cactcatgtt gagacttaat      6840
     ccctaatgtg gcaatactga aaggtggggc ctttgagatg tgattggatc gtaaggctgt      6900
     gccttcattc atgggttaat ggattaatgg gttatcacag gaatgggact ggtggcttta      6960
     taagaagagg aaaagagaac tgagctagca tgcccagccc acagagagcc tccactagag      7020
     tgatgctaag tggaaatgtg aggtgcagct gccacagagg gcccccacca gggaaatgtc      7080
     tagtgtctag tggatccagg ccacaggaga gagtgccttg tggagcgctg ggagcaggac      7140
     ctgaccacca ccaggacccc agaactgtgg agtcagtggc agcatgcagc gcccccttgg      7200
     gaaagcttta ggcaccagcc tgcaacccat tcgagcagcc acgtaggctg cacccagcaa      7260
     agccacaggc acggggctac ctgaggcctt gggggcccaa tccctgctcc agtgtgtccg      7320
     tgaggcagca cacgaagtca aaagagatta ttctcttccc acagatacct tttctctccc      7380
     atgacccttt aacagcatct gcttcattcc cctcaccttc ccaggctgat ctgaggtaaa      7440
     ctttgaagta aaataaaagc tgtgtttgag catcatttgt atttcatttg tgcgttttgt      7500
     gccttgttgt tttaattttt taaccacatt caagctatcc tttggcttcc aatgccatgg      7560
     tccacccaga actgcattca ctggcccatg ttctagttct ggtcatgccg actttcccgt      7620
     tttcctggtg aatccctgta atcacctgag tctcattctg tcaggtgata tccagtaaga      7680
     aggcaacatg tgcggtgaga aagcccaggg agtcctgggt gtgaattttt actttgccat      7740
     ttcttcctgt gtgacacgcg gtggggcttc acctgtctga gctccagttc ctcatcttgt      7800
     acgtggcact gttttcttgg gagagtcatt ataaagctaa tataaagtac ctgtactgtg      7860
     gtttgaatgt gtcctccaaa aagcatgtgt tggaaactga atccacaatg caaccatatc      7920
     gggaagtgaa tcctaatggc tggctggcca tggaggttcc aactttatga atggattaat      7980
     actgattata aaagggcttg aggttgaggc aagttcaacc tcttgccctc actcacccac      8040
     ttgcctttac caagagatga tacagcaaaa agactcacca aatgccggga tcttgatatt      8100
     agacttctta tcctccagaa ccatgaaata ggctgctttg ctttataaat tactcagtct      8160
     gcgtattata ttacagcaac acaagatggg caacctgata cttaggtttc agttagtggt      8220
     agatattttt atttcaagca ttcctactgg agtattagtt tcttcataag cccagaatct      8280
     ttgcatttta gcaacaacaa ataagtcttt tttttttttt ttttt                      8325
//


spacer
spacer