Dbfetch

ID   AY645723; SV 1; linear; mRNA; STD; HUM; 1322 BP.
XX
AC   AY645723;
XX
DT   31-MAR-2005 (Rel. 83, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Homo sapiens MHC class II antigen (HLA-DOB) mRNA, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1322
RX   DOI; 10.1111/j.1399-0039.2005.00375.x.
RX   PUBMED; 15730525.
RA   Gu H., Lee J.K., Oh B.;
RT   "Identification of a novel HLA-DOB-allele, DOB*010103, by sequence-based
RT   typing in the Korean population";
RL   Tissue Antigens 65(3):287-288(2005).
XX
RN   [2]
RP   1-1322
RA   Lee J.-K., Gu H.;
RT   ;
RL   Submitted (04-JUN-2004) to the INSDC.
RL   National Genome Research Institute, 5 Nokbeon-dong, Eunpyeng-gu, Seoul
RL   122-701, Republic of Korea
XX
DR   MD5; 5c9e0cd1468a16a0c0bb102b92d46821.
DR   Ensembl-Gn; ENSG00000239457; homo_sapiens.
DR   Ensembl-Gn; ENSG00000241106; homo_sapiens.
DR   Ensembl-Gn; ENSG00000241386; homo_sapiens.
DR   Ensembl-Gn; ENSG00000241910; homo_sapiens.
DR   Ensembl-Gn; ENSG00000243612; homo_sapiens.
DR   Ensembl-Tr; ENST00000426644; homo_sapiens.
DR   Ensembl-Tr; ENST00000438763; homo_sapiens.
DR   Ensembl-Tr; ENST00000447178; homo_sapiens.
DR   Ensembl-Tr; ENST00000454969; homo_sapiens.
DR   Ensembl-Tr; ENST00000456406; homo_sapiens.
DR   H-InvDB; HIT000332059_04.4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1322
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   gene            1..1322
FT                   /gene="HLA-DOB"
FT   CDS             57..878
FT                   /codon_start=1
FT                   /gene="HLA-DOB"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q5QNS2"
FT                   /db_xref="H-InvDB:HIT000332059_03.4"
FT                   /db_xref="IMGT/HLA:DOB*01:01:03:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QNS2"
FT                   /protein_id="AAV97948.1"
FT                   /translation="MGSGWVPWVVALLVNLTRLDSSMTQGTDSPEDFVIQAKADCYFTN
FT                   GTEKVQFVVRFIFNLEEYVRFDSDVGMFVALTKLGQPDAEQWNSRLDLLERSRQAVDGV
FT                   CRHNYRLGAPFTVGRKVQPEVTVYPERTPLLHQHNLLHCSVTGFYPGDIKIKWFLNGQE
FT                   ERAGVMSTGPIRNGDWTFQTVVMLEMTPELGHVYTCLVDHSSLLSPVSVEWRAQSEYSW
FT                   RKMLSGIAAFLLGLIFLLVGIVIQLRAQKGYVRTQMSGNEVSRAVLLPQSC"
FT   variation       152
FT                   /gene="HLA-DOB"
FT                   /replace="t"
XX
SQ   Sequence 1322 BP; 304 A; 321 C; 337 G; 360 T; 0 other;
     aactcattct gaagaggctg acgattttac tgtctcattt ttttcctttc tccagaatgg        60
     gttctgggtg ggtcccctgg gtggtggctc tgctagtgaa tctgacccga ctggattcct       120
     ccatgactca aggcacagac tctccagaag actttgtgat tcaggcaaag gctgactgtt       180
     acttcaccaa cgggacagaa aaggtgcagt ttgtggtcag attcatcttt aacttggagg       240
     agtatgtacg tttcgacagt gatgtgggga tgtttgtggc attgaccaag ctggggcagc       300
     cagatgctga gcagtggaac agccggctgg atctcttgga gaggagcaga caggccgtgg       360
     atggggtctg tagacacaac tacaggctgg gcgcaccctt cactgtgggg agaaaagtgc       420
     aaccagaggt gacagtgtac ccagagagga ccccactcct gcaccagcat aatctgctgc       480
     actgctctgt gacaggcttc tatccagggg atatcaagat caagtggttc ctgaatgggc       540
     aggaggagag agctggggtc atgtccactg gccctatcag gaatggagac tggacctttc       600
     agactgtggt gatgctagaa atgactcctg aacttggaca tgtctacacc tgccttgtcg       660
     atcactccag cctgctgagc cctgtttctg tggagtggag agctcagtct gaatattctt       720
     ggagaaagat gctgagtggc attgcagcct tcctacttgg gctaatcttc cttctggtgg       780
     gaatcgtcat ccagctaagg gctcagaaag gatatgtgag gacgcagatg tctggtaatg       840
     aggtctcaag agctgttctg ctccctcagt catgctaagg tcctcactga agcttctctc       900
     tctggagcct gaagtagtga tgagtagtct gggccctggg tgaggtaaag gacattcatg       960
     aggtcaatgt tctgggaata actctcttcc ctgatccttg gaggagcccg aactgattct      1020
     ggagctctgt gttctgagat catgcatctc ccacccatct gcccttctcc cttctacgtg      1080
     tacatcatta atccccattg ccaagggcat tgtccagaaa ctcccctgag accttactcc      1140
     ttccagcccc aaatcattta cttttctgtg gtccagccct actcctataa gtcatgatct      1200
     ccaaagcttt ctgtcttcca actgcagtct ccacagtctt cagaagacaa atgctcaggt      1260
     agtcactgtt tccttttcac tgtttttaaa aaccttttat tgtcaaataa aatggagata      1320
     ca                                                                     1322
//