spacer

EBI Dbfetch

ID   AY645722; SV 1; linear; mRNA; STD; HUM; 1358 BP.
XX
AC   AY645722;
XX
DT   31-MAR-2005 (Rel. 83, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Homo sapiens MHC class II antigen (HLA-DMB) mRNA, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1358
RX   DOI; 10.1111/j.1399-0039.2005.00385.x.
RX   PUBMED; 15787724.
RA   Gu H., Moon S.M., Kim J.J., Ryu H.J., Kwack K., Kimm K., Lee J.K., Oh B.;
RT   "Identification of a novel HLA-DMB allele (DMB*0107) in the Korean
RT   population";
RL   Tissue Antigens 65(4):393-394(2005).
XX
RN   [2]
RP   1-1358
RA   Lee J.-K., Gu H.;
RT   ;
RL   Submitted (04-JUN-2004) to the INSDC.
RL   National Genome Research Institute, 5 Nokbeon-dong, Eunpyeng-gu, Seoul
RL   122-701, Republic of Korea
XX
DR   MD5; 8b0db44719b528907822c35c99b64a41.
DR   Ensembl-Gn; ENSG00000226264; homo_sapiens.
DR   Ensembl-Gn; ENSG00000234154; homo_sapiens.
DR   Ensembl-Gn; ENSG00000239329; homo_sapiens.
DR   Ensembl-Gn; ENSG00000241296; homo_sapiens.
DR   Ensembl-Gn; ENSG00000241674; homo_sapiens.
DR   Ensembl-Gn; ENSG00000242092; homo_sapiens.
DR   Ensembl-Gn; ENSG00000242386; homo_sapiens.
DR   Ensembl-Gn; ENSG00000242574; homo_sapiens.
DR   Ensembl-Tr; ENST00000383231; homo_sapiens.
DR   Ensembl-Tr; ENST00000395312; homo_sapiens.
DR   Ensembl-Tr; ENST00000412948; homo_sapiens.
DR   Ensembl-Tr; ENST00000418107; homo_sapiens.
DR   Ensembl-Tr; ENST00000424822; homo_sapiens.
DR   Ensembl-Tr; ENST00000428420; homo_sapiens.
DR   Ensembl-Tr; ENST00000440078; homo_sapiens.
DR   Ensembl-Tr; ENST00000450897; homo_sapiens.
DR   H-InvDB; HIT000332058_03.4.
DR   H-InvDB; HIT000332058_04.4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1358
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   gene            1..1358
FT                   /gene="HLA-DMB"
FT   CDS             234..1025
FT                   /codon_start=1
FT                   /gene="HLA-DMB"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:P28068"
FT                   /db_xref="H-InvDB:HIT000332058_02.4"
FT                   /db_xref="HGNC:HGNC:4935"
FT                   /db_xref="IMGT/HLA:DMB*01:07"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:1HDM"
FT                   /db_xref="PDB:2BC4"
FT                   /db_xref="PDB:4FQX"
FT                   /db_xref="PDB:4GBX"
FT                   /db_xref="PDB:4I0P"
FT                   /protein_id="AAV97947.1"
FT                   /translation="MITFLPLLLGLSLGCTGAGGFVAHVESACLLDDAGTPKDFTYCIS
FT                   FNKVLLTCWDPEENKMAPCEFGVLNNLANVLSQHLNQKDTLMQRLRNGLQNCATHTQPF
FT                   WGSLTNRTRPPSVQVAKTTPFNTREPVMLACYVWGFYPAEVTITWRKNGKLVMPHSSAH
FT                   KTAQPNGDWTYQTLSHLALTPSYGDTYTCVVEHIGAPEPILRDWTPGLSPMQTLKVSVS
FT                   AVTLGLGLIIFSLGVISWRRAGHSSYTPLPGSNYSEGWHIS"
FT   variation       315
FT                   /gene="HLA-DMB"
FT                   /replace="a"
FT                   /note="results in alanine to threonine substitution"
FT   variation       379
FT                   /gene="HLA-DMB"
FT                   /replace="a"
FT                   /note="results in valine to aspartic acid substitution"
FT   variation       445
FT                   /gene="HLA-DMB"
FT                   /replace="g"
FT                   /note="results in asparagine to serine substitution"
XX
SQ   Sequence 1358 BP; 318 A; 367 C; 347 G; 326 T; 0 other;
     cctgtttggg acactggact cccgtgagct ggaaggaaca gatttaatat ctaggggctg        60
     ggtatcccca catcactcat ttggggggtc aagggacccg ggcaatatag tattctgctc       120
     agtgtctgga gatcatctac ccaggctggg gcttctggga caggcgagga cccacggacc       180
     ctggaagagc tggtccaggg gactgaactc ccggcatctt tacagagcag agcatgatca       240
     cattcctgcc gctgctgctg gggctcagcc tgggctgcac aggagcaggt ggcttcgtgg       300
     cccatgtgga aagcgcctgt ctgttggatg atgctgggac tccaaaggat ttcacatact       360
     gcatctcctt caacaaggtt ctgctgacct gctgggatcc agaggagaat aagatggccc       420
     cttgcgaatt tggggtgctg aataacttgg cgaatgtcct ctcacagcac ctcaaccaaa       480
     aagacaccct gatgcagcgc ttgcgcaatg ggcttcagaa ttgtgccaca cacacccagc       540
     ccttctgggg atcactgacc aacaggacac ggccaccatc tgtgcaagta gccaaaacca       600
     ctccttttaa cacgagggag cctgtgatgc tggcctgcta tgtgtggggc ttctatccag       660
     cagaagtgac tatcacgtgg aggaagaacg ggaagcttgt catgcctcac agcagtgcgc       720
     acaagactgc ccagcccaat ggagactgga cataccagac cctctcccat ttagccttaa       780
     ccccctctta cggggacact tacacctgtg tggtagagca cattggggct cctgagccca       840
     tccttcggga ctggacacct gggctgtccc ccatgcagac cctgaaggtt tctgtgtctg       900
     cagtgactct gggcctgggc ctcatcatct tctctcttgg tgtgatcagc tggcggagag       960
     ctggccactc tagttacact cctcttcctg ggtccaatta ttcagaagga tggcacattt      1020
     cctagaggca gaatcctaca acttccactc caagtgagaa ggagattcaa actcaatgat      1080
     gctaccatgc ctctccaaca tcttcaaccc cctgacatta tcttggatcc tatggtttct      1140
     ccatccaatt ctttgaattt cccagtctcc cctatgtaaa acttagcaac ttgggggacc      1200
     tcattcctgg gactatgctg taaccaaatt attgtccaag gctatatttc tgggatgaat      1260
     ataatctgag gaagggagtt aaagaccctc ctggggctct cagtgtgcca tagaggacag      1320
     caactggtga ttgtttcaga gaaataaact ttggtgga                              1358
//


spacer
spacer