spacer

EBI Dbfetch

ID   AY641577; SV 1; linear; genomic DNA; STD; HUM; 269 BP.
XX
AC   AY641577;
XX
DT   03-JUL-2004 (Rel. 80, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-269
RA   Sacchi N., Garbarino L., Pastori F., Chiesa A., Carcassi C.;
RT   ;
RL   Submitted (31-MAY-2004) to the INSDC.
RL   Lab. Istocompatibilita', E.O. Ospedali Galliera, Via A. Volta, 19/2,
RL   Genova, GE I-16128, Italy
XX
DR   MD5; b7142d52a298beeed433e6d2420f2f39.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..269
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>269
FT                   /gene="HLA-DRB1"
FT   mRNA            <1..>269
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>269
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q6DV47"
FT                   /db_xref="IMGT/HLA:DRB1*11:53"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DV47"
FT                   /protein_id="AAT64904.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEFRAV
FT                   TELGRPDEEYWNSQKDFLEQKRGQVDTYCRHNYGVGESFTVQRR"
FT   exon            <1..>269
FT                   /gene="HLA-DRB1"
FT                   /number=2
XX
SQ   Sequence 269 BP; 59 A; 61 C; 96 G; 53 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgatga ggagtactgg aacagccaga       180
     aggacttcct ggagcagaag cggggccagg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcga                                         269
//


spacer
spacer