Dbfetch

ID   AY640121; SV 1; linear; genomic DNA; STD; HUM; 898 BP.
XX
AC   AY640121;
XX
DT   01-APR-2005 (Rel. 83, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens isolate ML1209 MHC class I antigen (HLA-B) gene, HLA-B*1531
DE   allele, exons 2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-898
RX   DOI; 10.1111/j.1399-0039.2005.00338.x.
RX   PUBMED; 15713219.
RA   Luo M., Mao X., Plummer F.A.;
RT   "Identification of four novel HLA-B alleles, B*1590, B*1591, B*2726, and
RT   B*4705, from an East African population by high-resolution sequence-based
RT   typing";
RL   Tissue Antigens 65(2):187-191(2005).
XX
RN   [2]
RP   1-898
RA   Luo M., Mao X., Plummer F.A.;
RT   ;
RL   Submitted (27-MAY-2004) to the INSDC.
RL   Medical Microbiology, University of Manitoba, 730 William Ave., Winnipeg,
RL   Manitoba R3E 0W3, Canada
XX
DR   MD5; fbedefa90283351132d2c5101f481d25.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..898
FT                   /organism="Homo sapiens"
FT                   /isolate="ML1209"
FT                   /mol_type="genomic DNA"
FT                   /note="East African population"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>898
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1531"
FT   mRNA            join(<73..342,588..>863)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1531"
FT                   /product="MHC class I antigen"
FT   CDS             join(<73..342,588..>863)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1531"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:B*15:31"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:Q56SH7"
FT                   /protein_id="AAV54590.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMA
FT                   PRAPWIEQEGPEYWDRNTQISKTNTQTYRESLRNLRGYYNQSEAGSHTLQRMYGCDVGP
FT                   DGRLLRGYDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            73..342
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1531"
FT                   /number=2
FT   exon            588..863
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1531"
FT                   /number=3
XX
SQ   Sequence 898 BP; 153 A; 305 C; 324 G; 116 T; 0 other;
     gcgggggcgc aggacccggg gagccgcgcc gggaggaggg tcgggcgggt ctcagcccct        60
     cctcgccccc aggctcccac tccatgaggt atttctacac cgccatgtcc cggcccggcc       120
     gcggggagcc ccgcttcatc gcagtgggct acgtggacga cacccagttc gtgaggttcg       180
     acagcgacgc cgcgagtccg aggatggcgc cccgggcgcc atggatagag caggaggggc       240
     cggagtattg ggaccggaac acacagatct ccaagaccaa cacacagact taccgagaga       300
     gcctgcggaa cctgcgcggc tactacaacc agagcgaggc cggtgagtga ccccggcccg       360
     gggcgcaggt cacgactccc catcccccac gtacggcccg ggtcgccccg agtctccggg       420
     tccgagatcc gcccccctga ggccgcggga cccgcccaaa ccctcgaccg gcgagagccc       480
     caggcgcgtt tacccggttt cattttcagt tgaggccaaa atccccgcgg gttggtcggg       540
     gcggggcggg gctcggggga cggggctgac cgcggggcct gggccagggt ctcacaccct       600
     ccagaggatg tacggctgcg acgtggggcc ggacgggcgc ctcctccgcg ggtatgacca       660
     gtccgcctac gacggcaagg attacatcgc cctgaacgag gacctgagct cctggaccgc       720
     ggcggacacg gcggctcaga tcacccagcg caagtgggag gcggcccgtg tggcggagca       780
     gctgagagcc tacctggagg gcctgtgcgt ggagtggctc cgcagatacc tggagaacgg       840
     gaaggagacg ctgcagcgcg cgggtaccag gggcagtggg gagccttccc catctcct         898
//