spacer

EBI Dbfetch

ID   AY640120; SV 1; linear; genomic DNA; STD; HUM; 897 BP.
XX
AC   AY640120;
XX
DT   01-APR-2005 (Rel. 83, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens isolate ML1702 MHC class I antigen (HLA-B) gene, HLA-B*2726
DE   allele, exons 2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-897
RX   DOI; 10.1111/j.1399-0039.2005.00338.x.
RX   PUBMED; 15713219.
RA   Luo M., Mao X., Plummer F.A.;
RT   "Identification of four novel HLA-B alleles, B*1590, B*1591, B*2726, and
RT   B*4705, from an East African population by high-resolution sequence-based
RT   typing";
RL   Tissue Antigens 65(2):187-191(2005).
XX
RN   [2]
RP   1-897
RA   Luo M., Mao X., Plummer F.A.;
RT   ;
RL   Submitted (27-MAY-2004) to the INSDC.
RL   Medical Microbiology, University of Manitoba, 730 William Ave., Winnipeg,
RL   Manitoba R3E 0W3, Canada
XX
DR   MD5; 49a00c495f580d66f8650d9753d7bfc6.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..897
FT                   /organism="Homo sapiens"
FT                   /isolate="ML1702"
FT                   /mol_type="genomic DNA"
FT                   /note="East African population"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>897
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*2726"
FT   mRNA            join(<73..342,587..>862)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*2726"
FT                   /product="MHC class I antigen"
FT   CDS             join(<73..342,587..>862)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*2726"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q56SH8"
FT                   /db_xref="IMGT/HLA:B*27:26"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q56SH8"
FT                   /protein_id="AAV54589.1"
FT                   /translation="SHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRETQICKAQAQTDRESLRNLRGYYNQSEAGSHTLQNMYGCDVGP
FT                   DGRLLRGYHQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGEC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            73..342
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*2726"
FT                   /number=2
FT   exon            587..862
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*2726"
FT                   /number=3
XX
SQ   Sequence 897 BP; 150 A; 300 C; 335 G; 112 T; 0 other;
     gcgggggcgc aggacccggg gagccgcgcc gggaggaggg tcgggcgggt ctcagcccct        60
     cctcgccccc aggctcccac tccatgaggt atttccacac ctccgtgtcc cggcccggcc       120
     gcggggagcc ccgcttcatc accgtgggct acgtggacga cacgctgttc gtgaggttcg       180
     acagcgacgc cgcgagtccg agagaggagc cgcgggcgcc gtggatagag caggaggggc       240
     cggagtattg ggaccgggag acacagatct gcaaggccca ggcacagact gaccgagaga       300
     gcctgcggaa cctgcgcggc tactacaacc agagcgaggc cggtgagtga ccccggcccg       360
     gggcgcaggt cacgactccc catcccccac gtacggcccg ggtcgccccg agtctccggg       420
     tccgagatcc gcccccgagg ccgcgggacc cgcccagacc ctcgaccggc gagagcccca       480
     ggcgcgttta cccggtttca ttttcagttg aggccaaaat ccccgcgggt tggtcggggc       540
     ggggcggggc tcggggggac ggggctgacc gcgggggcgg ggccagggtc tcacaccctc       600
     cagaatatgt atggctgcga cgtggggccg gacgggcgcc tcctccgcgg gtaccaccag       660
     gacgcctacg acggcaagga ttacatcgcc ctgaacgagg acctgagctc ctggaccgcc       720
     gcggacacgg cggctcagat cacccagcgc aagtgggagg cggcccgtgt ggcggagcag       780
     ctgagagcct acctggaggg cgagtgcgtg gagtggctcc gcagatacct ggagaacggg       840
     aaggagacgc tgcagcgcgc gggtaccagg ggcagtgggg agccttcccc atctcct          897
//


spacer
spacer