Dbfetch

ID   AY626552; SV 1; linear; mRNA; STD; HUM; 801 BP.
XX
AC   AY626552;
XX
DT   01-JAN-2005 (Rel. 82, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) mRNA, HLA-DRB1*040101 allele,
DE   complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-801
RA   Lee E., Kim E., Kwack K.;
RT   "Identification of HLA-DRB1*040101 variant in the Korean population";
RL   Unpublished.
XX
RN   [2]
RP   1-801
RA   Lee E., Kim E., Kwack K.;
RT   ;
RL   Submitted (14-MAY-2004) to the INSDC.
RL   National Genome Research Institute, Korea National Institute of Health, #5
RL   Nokbun-dong, Eunpyung-gu, Seoul 122-701, Republic of Korea
XX
DR   MD5; 7bd3ebcae156237fb8127ce06c9afff1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..801
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   gene            1..801
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*040101"
FT   CDS             1..801
FT                   /codon_start=1
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*040101"
FT                   /product="MHC class II antigen"
FT                   /note="HLA-DR-beta chain"
FT                   /db_xref="GOA:Q5IWM0"
FT                   /db_xref="H-InvDB:HIT000332028_03.4"
FT                   /db_xref="IMGT/HLA:DRB1*04:05:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="UniProtKB/TrEMBL:Q5IWM0"
FT                   /protein_id="AAV41230.1"
FT                   /translation="MVCLRLPGGSCMAALTVTLMVLSSPLALAGDTRPRFLEQVKHECH
FT                   FFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAVTELGRPSAEYWNSQKDLLEQRRAAV
FT                   DTYCRHNYGVGESFTVQRRVYPEVTVYPAKTQPLQHHNLLVCSVNGFYPGSIEVRWFRN
FT                   GQEEKTGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSLTSPLTVEWRARSE
FT                   SAQSKMLSGVGGFVLGLLFLGAGLSIYFRNQKGHSGLQPTGFLS"
XX
SQ   Sequence 801 BP; 171 A; 209 C; 260 G; 161 T; 0 other;
     atggtgtgtc tgaggctccc tggaggctcc tgcatggcag ctctgacagt gacactgatg        60
     gtgctgagct ccccactggc tttggctggg gacacccgac cacgtttctt ggagcaggtt       120
     aaacatgagt gtcatttctt caacgggacg gagcgggtgc ggttcctgga cagatacttc       180
     tatcaccaag aggagtacgt gcgcttcgac agcgacgtgg gggagtaccg ggcggtgacg       240
     gagctggggc ggcctagcgc cgagtactgg aacagccaga aggacctcct ggagcagagg       300
     cgggccgcgg tggacaccta ctgcagacac aactacgggg ttggtgagag cttcacagtg       360
     cagcggcgag tctatcctga ggtgactgtg tatcctgcaa agacccagcc cctgcagcac       420
     cacaacctcc tggtctgctc tgtgaatggt ttctatccag gcagcattga agtcaggtgg       480
     ttccggaacg gccaggaaga gaagactggg gtggtgtcca caggcctgat ccagaatgga       540
     gactggacct tccagaccct ggtgatgctg gaaacagttc ctcggagtgg agaggtttac       600
     acctgccaag tggagcaccc aagcctgacg agccctctca cagtggaatg gagagcacgg       660
     tctgaatctg cacagagcaa gatgctgagt ggagtcgggg gcttcgtgct gggcctgctc       720
     ttccttgggg ccgggctgtc catctacttc aggaatcaga aaggacactc tggacttcag       780
     ccaacaggat tcctgagctg a                                                 801
//