spacer

EBI Dbfetch

ID   AY626551; SV 1; linear; mRNA; STD; HUM; 801 BP.
XX
AC   AY626551;
XX
DT   30-OCT-2004 (Rel. 81, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) mRNA, HLA-DRB1*120101 allele,
DE   complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-801
RX   DOI; 10.1111/j.1399-0039.2004.00309.x.
RX   PUBMED; 15361134.
RA   Kim E., Lee E.J., Lim Y.H., Lee J.Y., Koh I.S., Kimm K., Ji G.E., Kwack K.;
RT   "Identification of a novel HLA-DRB1*12 allele (DRB1*1210) in the Korean
RT   population";
RL   Tissue Antigens 64(4):518-519(2004).
XX
RN   [2]
RP   1-801
RA   Kim E., Lee E.J., Kwack K.;
RT   ;
RL   Submitted (14-MAY-2004) to the INSDC.
RL   National Genome Research Institute, Korea National Institute of Health, #5
RL   Nokbun-dong, Eunpyung-gu, Seoul 122-701, Republic of Korea
XX
DR   MD5; 9e71b7c23cd89d7e83e8d55b88266b17.
DR   Ensembl-Gn; ENSG00000206240; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206306; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228080; homo_sapiens.
DR   Ensembl-Tr; ENST00000328980; homo_sapiens.
DR   Ensembl-Tr; ENST00000399450; homo_sapiens.
DR   Ensembl-Tr; ENST00000412634; homo_sapiens.
DR   Ensembl-Tr; ENST00000415796; homo_sapiens.
DR   Ensembl-Tr; ENST00000419393; homo_sapiens.
DR   Ensembl-Tr; ENST00000428566; homo_sapiens.
DR   H-InvDB; HIT000255777_06.4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..801
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   gene            1..801
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*120101"
FT   CDS             1..801
FT                   /codon_start=1
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*120101"
FT                   /product="MHC class II antigen"
FT                   /note="HLA-DR-beta chain"
FT                   /db_xref="GOA:Q95IE3"
FT                   /db_xref="H-InvDB:HIT000255777_05.4"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*12:10"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q95IE3"
FT                   /protein_id="AAV34808.1"
FT                   /translation="MVCLRLPGGSCMAILTVTLMVLSSPLALAGDTRPRFLEYSTGECY
FT                   FFNGTERVRLLERHFHNQEELLRFDSDVGEFRAVTELGRPVAESWNSQKDILEDRRAAV
FT                   DTYCRHNYGAVESFTVQRRVHPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRN
FT                   GQEEKTGVVSTGLIHNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSE
FT                   SAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPRGFLS"
XX
SQ   Sequence 801 BP; 169 A; 204 C; 259 G; 169 T; 0 other;
     atggtgtgtc tgaggctccc tggaggctcc tgcatggcaa ttctgacagt gacactgatg        60
     gtgctgagct ccccactggc tttggctggg gacaccagac cacgtttctt ggagtactct       120
     acgggtgagt gttatttctt caatgggacg gagcgggtgc ggttactgga gagacacttc       180
     cataaccagg aggagctcct gcgcttcgac agcgacgtgg gggagttccg ggcggtgacg       240
     gagctggggc ggcctgtcgc cgagtcctgg aacagccaga aggacatcct ggaagacagg       300
     cgcgccgcgg tggacaccta ttgcagacac aactacgggg ctgtggagag cttcacagtg       360
     cagcggcgag tccatcctaa ggtgactgtg tatccttcaa agacccagcc cctgcagcac       420
     cacaacctcc tggtctgttc tgtgagtggt ttctatccag gcagcattga agtcaggtgg       480
     ttccggaatg gccaggaaga gaagactggg gtggtgtcca cgggcctgat ccacaatgga       540
     gactggacct tccagaccct ggtgatgctg gaaacagttc ctcggagtgg agaggtttac       600
     acctgccaag tggagcaccc aagcgtgaca agccctctca cagtggaatg gagagcacgg       660
     tctgaatctg cacagagcaa gatgctgagt ggagtcgggg gctttgtgct gggcctgctc       720
     ttccttgggg ccgggctgtt catctacttc aggaatcaga aaggacactc tggacttcag       780
     ccaagaggat tcctgagctg a                                                 801
//


spacer
spacer