spacer

EBI Dbfetch

ID   AY623606; SV 1; linear; genomic DNA; STD; HUM; 3058 BP.
XX
AC   AY623606;
XX
DT   08-JUN-2004 (Rel. 80, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens isolate 39529S MHC class I antigen precusor (HLA-Cw) gene,
DE   HLA-Cw*1213 allele, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3058
RA   Robbins F.-M., Adams S., Uribe M., Childs R., Klein H.;
RT   "Identification of novel HLA class I alleles by direct sequencing of
RT   SSP-PCR products";
RL   Unpublished.
XX
RN   [2]
RP   1-3058
RA   Robbins F.-M., Adams S., Uribe M., Childs R., Klein H.;
RT   ;
RL   Submitted (11-MAY-2004) to the INSDC.
RL   Transfusion Medicine, NIH, CC, 9000 Rockville Pike, Bethesda, MD 20892, USA
XX
DR   MD5; 807b94f9d89314085415b5578b24a778.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3058
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /isolate="39529S"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>3058
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*1213"
FT   mRNA            join(<1..195,326..595,842..1117,1705..1980,2102..2221,
FT                   2661..2693,2801..2848,3013..>3058)
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*1213"
FT                   /product="MHC class I antigen precusor"
FT   exon            <1..195
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*1213"
FT                   /number=1
FT   CDS             join(123..195,326..595,842..1117,1705..1980,2102..2221,
FT                   2661..2693,2801..2848,3013..3017)
FT                   /codon_start=1
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*1213"
FT                   /product="MHC class I antigen precusor"
FT                   /note="HLA-Cw*12 variant, antigen presenting molecule"
FT                   /db_xref="GOA:Q6IUU7"
FT                   /db_xref="IMGT/HLA:C*12:13"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q6IUU7"
FT                   /protein_id="AAT39989.1"
FT                   /translation="MRVMAPRTLILLLSGALALTETWACSHSMRYFYTAVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQADRVSLRN
FT                   LRGYYNQSEAGSHTLQWMYGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWIAADTA
FT                   AQITQRKWEAAREAEQWRAYLEGTCVEWLRRYLENGKETLQRAEHPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPEPLTLRWEPSSQPTIPIVGIVAGLAVLAVLAVLGAVMAVVMCRRKSSGG
FT                   KGGSCSQAASSNSAQGSDESLIACKA"
FT   exon            326..595
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*1213"
FT                   /number=2
FT   exon            842..1117
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*1213"
FT                   /number=3
FT   exon            1705..1980
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*1213"
FT                   /number=4
FT   exon            2102..2221
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*1213"
FT                   /number=5
FT   exon            2661..2693
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*1213"
FT                   /number=6
FT   exon            2801..2848
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*1213"
FT                   /number=7
FT   exon            3013..>3058
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*1213"
FT                   /number=8
XX
SQ   Sequence 3058 BP; 572 A; 892 C; 967 G; 627 T; 0 other;
     cgctccccaa ttcccactcc cattgggtgt cgggttctag agaagccaat cagcgtctcc        60
     gcagtcccgg ttctaaagtc cccagtcacc cacccggact cggattctcc ccagacgccg       120
     agatgcgggt catggcgccc cgaaccctca tcctgctgct ctcgggagcc ctggccctga       180
     ccgagacctg ggcctgtgag tgcggggttg ggagggaaac ggcctctgcg gagaggagcg       240
     aggggcccgc ccggcgaggg cgcaggaccc ggggagccgc gcagggagga gggtcgggcg       300
     ggtctcagcc cctcctcgcc cccaggctcc cactccatga ggtatttcta caccgccgtg       360
     tcccggcccg gccgcggaga gccccgcttc atcgcagtgg gctacgtgga cgacacgcag       420
     ttcgtgcggt tcgacagcga cgccgcgagt ccaagagggg agccgcgggc gccgtgggtg       480
     gagcaggagg ggccggagta ttgggaccgg gagacacaga agtacaagcg ccaggcacag       540
     gctgaccgag tgagcctgcg gaacctgcgc ggctactaca accagagcga ggccggtgag       600
     tgaccccggc ccggggcgca ggtcacgacc cctccccatc ccccacggac ggcccgggtc       660
     gccccgagtc tcccggtctg agatccaccc cgaggctgcg gaacccgccc agaccctcga       720
     ccggagagag ccccagtcac ctttacccgg tttcattttc agtttaggcc aaaatccccg       780
     cgggttggtc ggggctgggg cggggctcgg gggacggggc tgaccacggg ggcggggcca       840
     gggtctcaca ccctccagtg gatgtatggc tgcgacctgg ggcccgacgg gcgcctcctc       900
     cgcgggtatg accagtccgc ctacgacggc aaggattaca tcgccctgaa cgaggacctg       960
     cgctcctgga ttgccgcgga cacggcggct cagatcaccc agcgcaagtg ggaggcggcc      1020
     cgtgaggcgg agcagtggag agcctacctg gagggcacgt gcgtggagtg gctccgcaga      1080
     tacctggaga acgggaagga gacgctgcag cgcgcgggta ccaggggcag tggggagcct      1140
     tccccatctc ctgtagatct cccgggatgg cctcccacga ggaggggagg aaaatgggat      1200
     cagcgctaga atatcgccct cccttgaatg gagaatggga tgagttttcc tgagtttcct      1260
     ctgagggccc cctctgctct ctaggacaat taagggatga agtccttgag gaaatggagg      1320
     ggaagacagt ccctggaata ctgatcaggg gtcccctttg accactttga ccactgcagc      1380
     agctgtggtc aggctgctga cctttctctc aggccttgtt ctctgcctca cgctcaatgt      1440
     gtttaaaggt ttgattccag cttttctgag tccttcggcc tccactcagg tcaggaccag      1500
     aagtcgctgt tcctccctca gagactagaa ctttccaatg aataggagat tatcccaggt      1560
     gcctgtgtcc aggctggcgt ctgggttctg tgcccccttc cccaccccag gtgtcctgtc      1620
     cattctcagg atggtcacat gggcgctgtt ggagtgtcgc aagagagata caaagtgtct      1680
     gaattttctg actcttcccg tcagaacacc caaagacaca cgtgacccac catcccgtct      1740
     ctgaccatga ggccaccctg aggtgctggg ccctgggctt ctaccctgcg gagatcacac      1800
     tgacctggca gcgggatggc gaggaccaaa ctcaggacac cgagcttgtg gagaccaggc      1860
     cagcaggaga tggaaccttc cagaagtggg cagctgtggt ggtgccttct ggagaagagc      1920
     agagatacac gtgccatgtg cagcacgagg ggctgccaga gcccctcacc ctgagatggg      1980
     gtaaggaggg ggatgagggg tcatgtgtct tctcagggaa agcagaagtc ctggagccct      2040
     tcagccgggt cagggctgag gcttgggggt cagggcccct caccttcccc tcctttccca      2100
     gagccatctt cccagcccac catccccatc gtgggcatcg ttgctggcct ggctgtcctg      2160
     gctgtcctag ctgtcctagg agctgtgatg gctgttgtga tgtgtaggag gaagagctca      2220
     ggtagggaag gggtgaggag tggggtctgg gttttcttgt cccactggga gtttcaagcc      2280
     ccaggtagaa gtgtgcccca cctcgttact ggaagcacca tccacacatg ggccatccca      2340
     gcctgggacc ctgtgtgcta gcacttactc tgttgtgaag cacatgacaa tgaaggacag      2400
     atgtatcacc ttgatgatta tggtgttggg gtccttgatt ccagcattca tgagtcaggg      2460
     gaaggtccct gctaaggaca gaccttagga gggcagttgc tccagaaccc acagctgctt      2520
     tccccgtgtt tcctgatcct gccctgggtc tgcagtcata gttctggaaa cttctcttgg      2580
     gtccaagact aggaggttcc cctaagatcg catggccctg cctcctccct gtcccctcac      2640
     agggcatttt cttcccacag gtggaaaagg agggagctgc tctcaggctg cgtgtaagtg      2700
     atggcggtgg gcgtgtggag gagctcaccc accccataat tcctcttgtc ccacatctcc      2760
     tgcgggctct gaccaggtct ttttttttgt tctaccccag ccagcaacag tgcccagggc      2820
     tctgatgagt ctctcatcgc ttgtaaaggt gagattctgg ggagctgaag tggtctgggg      2880
     tggggcagag ggaaaaggcc taggtaatgg ggatcctttg attgggacgt ttcgaatgtg      2940
     tggtgagctg ttcagagtgt catcacttac catgactgac ctgaatttgt tcatgactat      3000
     tgtgttctgt agcctgagac agctgcctgt gtgggactga gatgcaggat ttcttcac        3058
//


spacer
spacer