Dbfetch

ID   AY623605; SV 1; linear; genomic DNA; STD; HUM; 2161 BP.
XX
AC   AY623605;
XX
DT   08-JUN-2004 (Rel. 80, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class I antigen precusor (HLA-B) gene, HLA-B*08 allele,
DE   exons 1 through 5 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2161
RA   Robbins F.-M., Adams S., Wagage D., Merincola F.;
RT   "Identification of novel HLA class I alleles by direct sequencing of
RT   SSP-PCR products";
RL   Unpublished.
XX
RN   [2]
RP   1-2161
RA   Robbins F.-M., Adams S., Wagage D., Merincola F.;
RT   ;
RL   Submitted (11-MAY-2004) to the INSDC.
RL   Transfusion Medicine, NIH, CC, 9000 Rockville Pike, Bethesda, MD 20892, USA
XX
DR   MD5; 6e33deda568fc87d14e108db09a0eef8.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2161
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /isolate="32150S"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>2161
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*08"
FT   mRNA            join(<1..90,219..488,735..1010,1583..1858,1952..>2068)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*08"
FT                   /product="MHC class I antigen precusor"
FT   exon            <1..90
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*08"
FT                   /number=1
FT   CDS             join(18..90,219..488,735..1010,1583..1858,1952..>2068)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*08"
FT                   /product="MHC class I antigen precusor"
FT                   /note="HLA-B*08 variant, antigen presenting molecule"
FT                   /db_xref="GOA:Q6IUU8"
FT                   /db_xref="IMGT/HLA:B*08:01:04"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q6IUU8"
FT                   /protein_id="AAT39988.1"
FT                   /translation="MLVMAPRTVLLLLSAALALTETWAGSHSMRYFDTAMSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIFKTNTQTDRESLRN
FT                   LRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAARVAEQDRAYLEGTCVEWLRRYLENGKDTLERADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSS"
FT   exon            219..488
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*08"
FT                   /number=2
FT   exon            735..1010
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*08"
FT                   /number=3
FT   exon            1583..1858
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*08"
FT                   /number=4
FT   exon            1952..2068
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*08"
FT                   /number=5
XX
SQ   Sequence 2161 BP; 401 A; 660 C; 709 G; 391 T; 0 other;
     tctcctcaga cgccgagatg ctggtcatgg cgccccgaac cgtcctcctg ctgctctcgg        60
     cggccctggc cctgaccgag acctgggccg gtgagtgcgg gtcgggaggg aaatggcctc       120
     tgccgggagg agcgagggga ccgcaggcgg gggcgcagga cctgaggagc cgcgccggga       180
     ggagggtcgg gcgggtctca gcccctcctc gcccccaggc tcccactcca tgaggtattt       240
     cgacaccgcc atgtcccggc ccggccgcgg ggagccccgc ttcatctcag tgggctacgt       300
     ggacgacacg cagttcgtga ggttcgacag cgacgccgcg agtccgagag aggagccgcg       360
     ggcgccgtgg atagagcagg aggggccgga gtattgggac cggaacacac agatcttcaa       420
     gaccaacaca cagactgacc gagagagctt gcggaacctg cgcggctact acaaccagag       480
     cgaggccggt gagtgacccc ggcccggggc gcaggtcacg actccccatc ccccacggac       540
     ggcccgggtc gccccgagtc tccgggtccg agatccgcct ccctgaggcc gcgggacccg       600
     cccagaccct cgaccggcga gagccccagg cgcgtttacc cggtttcatt ttcagttgag       660
     gccaaaatcc ccgcgggttg gtcggggcgg ggcggggctc ggggggacgg ggctgaccgc       720
     ggggccgggg ccagggtctc acaccctcca gagcatgtac ggctgcgacg tggggccgga       780
     cgggcgcctc ctccgcgggc ataaccagta cgcctacgac ggcaaggatt acatcgccct       840
     gaacgaggac ctgcgctcct ggaccgcggc ggacaccgcg gctcagatca cccagcgcaa       900
     gtgggaggcg gcccgtgtgg cggagcagga cagagcctac ctggagggca cgtgcgtgga       960
     gtggctccgc agatacctgg agaacgggaa ggacacgctg gagcgcgcgg gtaccagggg      1020
     cagtggggag ccttccccat ctcctatagg tcgccgggga tggcctccca cgagaagagg      1080
     aggaaaatgg gatcagcgct agaatgtcgc cctcccttga atggagaatg gcatgagttt      1140
     tcctgagttt cctctgaggg ccccctcttc tctctagaca attaagggat gacgtctctg      1200
     aggaaatgga ggggaagaca gtccctagaa tactgatcag gggtcccctt tgacccctgc      1260
     agcagccttg ggaaccgtga cttttcctct caggccttgt tctctgcctc acactcagtg      1320
     tgtttggggc tctgattcca gcacttctga gtcactttac ctccactcag atcaggagca      1380
     gaagtccctg ttccccgctc agagactcga actttccaat gaataggaga ttatcccagg      1440
     tgcctgcatc cgctggtgtc tgggttctgt gccccttccc caccccaggt gtcctgtcca      1500
     ttctcaggct ggtcacatgg gtggtcctag ggtgtgccat gagagatgca aagcgcctga      1560
     attttctgac tcttcccatc agacccccca aagacacacg tgacccacca ccccatctct      1620
     gaccatgagg ccaccctgag gtgctgggcc ctgggcttct accctgcgga gatcacactg      1680
     acctggcagc gggatggcga ggaccaaact caggacactg agcttgtgga gaccagacca      1740
     gcaggagata gaaccttcca gaagtgggca gctgtggtgg tgccttctgg agaagagcag      1800
     agatacacat gccatgtaca gcatgagggg ctgccgaagc ccctcaccct gagatggggt      1860
     aaggaggggg atgaggggtc atatctcttc tcagggaaag caggagccct tcagcagggt      1920
     cagggcccct catcttcccc tcctttccca gagccgtctt cccagtccac cgtccccatc      1980
     gtgggcattg ttgctggcct ggctgtccta gcagttgtgg tcatcggagc tgtggtcgct      2040
     gctgtgatgt gtaggaggaa gagctcaggt agggaagggg tgaggggtgg ggtctgggtt      2100
     ttcttgtccc actgggggtt tcaagcccca ggtagaagtg ttccctgcct cattactggg      2160
     a                                                                      2161
//