spacer

EBI Dbfetch

ID   AY623048; SV 1; linear; genomic DNA; STD; HUM; 1964 BP.
XX
AC   AY623048;
XX
DT   27-MAY-2004 (Rel. 80, Created)
DT   12-DEC-2012 (Rel. 115, Last updated, Version 5)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*2902 variant allele,
DE   exons 1 through 4 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1964
RX   DOI; 10.1016/j.humimm.2011.10.013.
RX   PUBMED; 22074999.
RA   Paximadis M., Mathebula T.Y., Gentle N.L., Vardas E., Colvin M., Gray C.M.,
RA   Tiemessen C.T., Puren A.;
RT   "Human leukocyte antigen class I (A, B, C) and II (DRB1) diversity in the
RT   black and Caucasian South African population";
RL   Hum. Immunol. 73(1):80-92(2012).
XX
RN   [2]
RP   1-1964
RA   Puren A.J., Paximadis M., Mathebula T.Y.;
RT   "Distribution of HLA class I and II alleles in the South African population
RT   and its impact on the design of an epitope-based HIV-1 vaccine";
RL   Unpublished.
XX
RN   [3]
RP   1-1964
RA   Puren A.J., Paximadis M.;
RT   ;
RL   Submitted (12-MAY-2004) to the INSDC.
RL   AIDS Unit, National Institute for Communicable Diseases, 1 Modderfontein
RL   Rd., Sandringham, Johannesburg, Gauteng 2131, South Africa
XX
DR   MD5; 4413f800d6f891e1e6ac2a9dffb28b38.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1964
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1964
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2902 variant"
FT   mRNA            join(<1..73,203..472,714..989,1590..>1865)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2902 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(1..73,203..472,714..989,1590..>1865)
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2902 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q6IUZ5"
FT                   /db_xref="IMGT/HLA:A*29:11"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q6IUZ5"
FT                   /protein_id="AAT35597.1"
FT                   /translation="MAVMAPRTLLLLLLGALALTQTWAGSHSMRYFTTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDLQTRNVKAQSQTDRANLGT
FT                   LRGYYNQSEAGSHTIQMMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMA
FT                   APITQRKWEAARVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHE
FT                   ATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWASVVVPSGQEQRY
FT                   TCHVQHEGLPKPLTLRW"
FT   exon            <1..73
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2902 variant"
FT                   /number=1
FT   exon            203..472
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2902 variant"
FT                   /number=2
FT   exon            714..989
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2902 variant"
FT                   /number=3
FT   exon            1590..1865
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2902 variant"
FT                   /number=4
XX
SQ   Sequence 1964 BP; 363 A; 603 C; 640 G; 358 T; 0 other;
     atggccgtca tggcgccccg aaccctcctc ctgctactct tgggggccct ggccctgacc        60
     cagacctggg cgggtgagtg cggggtcgtg gggaaaccgc ctctgcgggg agaagcaagg       120
     ggcccgcccg gcggggacgc aggacccggg tagccgcgcc gggaggaggg tcgggtgggt       180
     ctcagccact cctcgccccc aggctcccac tccatgaggt atttcaccac atccgtgtcc       240
     cggcccggcc gcggggagcc ccgcttcatc gccgtgggct acgtggacga cacgcagttc       300
     gtgcggtttg acagcgacgc cgcgagccag aggatggagc cgcgggcacc gtggatagag       360
     caggaggggc cggagtattg ggacctgcag acacggaatg tgaaggccca gtcacagact       420
     gaccgagcga acctggggac cctgcgcggc tactacaacc agagcgaggc cggtgagtga       480
     ccccggcccg gggcgcaggt cacgacctct catcccccac ggacgggccg ggtcgcccac       540
     agtctccggg tccgagatcc accccgaagc cgcgggaccc cgagaccctt gccccgggag       600
     aggcccaggc gcctttaccc ggtttcattt tcagtttagg ccaaaaatcc ccccgggttg       660
     gtcggggccg gacggggctc gggggactgg gctgaccgtg gggtcggggc caggttctca       720
     caccatccag atgatgtatg gctgcgacgt ggggtcggac gggcgcttcc tccgcgggta       780
     ccggcaggac gcctacgacg gcaaggatta catcgccttg aacgaggacc tgcgctcttg       840
     gaccgcggcg gacatggcgg ctccgatcac ccagcgcaag tgggaggcgg cccgtgtggc       900
     ggagcagttg agagcctacc tggagggcac gtgcgtggag tggctccgca gatacctgga       960
     gaacgggaag gagacgctgc agcgcacggg taccgggggc cacggggcgc ctccctgatc      1020
     gcctgtagat ctcccgggct ggcctcccac aaggagggga gacaattggg accaacacta      1080
     gaatatcgcc ctccctctgg tcctgaggga gaggaatcct cctgggtttc cagatcctgt      1140
     accagagagt gactctgagg ttccgccctg ctctctgaca caattaaggg ataaaatctc      1200
     tgaaggaatg acgggaagac gatccctcga atactgatga gtggttccct ttgacacaca      1260
     ccggcagcag ccttgggccc gtgacttttc ctctcaggcc ttgttctctg cttcacactc      1320
     aatgtgtgtg ggggtctgag tccagcactt ctgagtccct cagcctccac tcaggtcagg      1380
     accagaagtc gctgttccct cttcagggac tagaattttc cacggaatag gagattatcc      1440
     caggtgcctg tgtccaggct ggtgtctggg ttctgtgctc ccttccccat cccaggtgtc      1500
     ctgtccattc tcaagatagc cacatgtgtg ctggaggagt gtcccatgac agatgcaaaa      1560
     tgcctgaatg ttctgactct tcctgacaga cgcccccaag acgcatatga ctcaccacgc      1620
     tgtctctgac catgaggcca ccctgaggtg ctgggccctg agcttctacc ctgcggagat      1680
     cacactgacc tggcagcggg atggggagga ccagacccag gacacggagc ttgtggagac      1740
     caggcctgca ggggatggaa ccttccagaa gtgggcgtct gtggtggtgc cttctggaca      1800
     ggagcagaga tacacctgcc atgtgcagca tgagggtctg cccaagcccc tcaccctgag      1860
     atggggtaag gagggagatg ggggtgtcat gtcttttagg gaaagcagga gcctctctga      1920
     cctttagcag ggtcagggcc cctcaccttc ccctcttttc ccag                       1964
//


spacer
spacer