Dbfetch

ID   AY621109; SV 1; linear; genomic DNA; STD; HUM; 1947 BP.
XX
AC   AY621109;
XX
DT   27-MAY-2004 (Rel. 80, Created)
DT   12-DEC-2012 (Rel. 115, Last updated, Version 5)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*3002 variant allele,
DE   exons 1 through 4 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1947
RX   DOI; 10.1016/j.humimm.2011.10.013.
RX   PUBMED; 22074999.
RA   Paximadis M., Mathebula T.Y., Gentle N.L., Vardas E., Colvin M., Gray C.M.,
RA   Tiemessen C.T., Puren A.;
RT   "Human leukocyte antigen class I (A, B, C) and II (DRB1) diversity in the
RT   black and Caucasian South African population";
RL   Hum. Immunol. 73(1):80-92(2012).
XX
RN   [2]
RP   1-1947
RA   Puren A.J., Paximadis M., Mathebula T.Y.;
RT   "Distribution of HLA class I and II alleles in the South African population
RT   and its impact on the design of an epitope-based HIV-1 vaccine";
RL   Unpublished.
XX
RN   [3]
RP   1-1947
RA   Puren A.J., Paximadis M.;
RT   ;
RL   Submitted (12-MAY-2004) to the INSDC.
RL   AIDS Unit, National Institute for Communicable Diseases, 1 Modderfontein
RL   Rd., Sandringham, Johannesburg, Gauteng 2131, South Africa
XX
DR   MD5; 9a12da8667d1c2f3d52258612cb470df.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1947
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1947
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*3002 variant"
FT   mRNA            join(<1..73,204..473,715..990,1570..>1845)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*3002 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(1..73,204..473,715..990,1570..>1845)
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*3002 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:A*30:02:02"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q6IV48"
FT                   /protein_id="AAT35596.1"
FT                   /translation="MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFSTSVSRPGSGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQERPEYWDQETRNVKAHSQTDRENLGT
FT                   LRGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYEQHAYDGKDYIALNEDLRSWTAADMA
FT                   AQITQRKWEAARRAEQLRAYLEGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRW"
FT   exon            <1..73
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*3002 variant"
FT                   /number=1
FT   exon            204..473
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*3002 variant"
FT                   /number=2
FT   exon            715..990
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*3002 variant"
FT                   /number=3
FT   exon            1570..1845
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*3002 variant"
FT                   /number=4
XX
SQ   Sequence 1947 BP; 365 A; 597 C; 633 G; 352 T; 0 other;
     atggccgtca tggcgccccg aaccctcctc ctgctactct cgggggccct ggccctgacc        60
     cagacctggg cgggtgagtg cggggtcggg agggaaaccg cctctgcggg gagaagcaag       120
     gggccctcct ggcgggggcg caggaccggg ggagccgcgc cgggaggagg gtcggtcagg       180
     tctcagccac tgctcgcccc caggctccca ctccatgagg tatttctcca catccgtgtc       240
     ccggcccggc agtggagagc cccgcttcat cgcagtgggc tacgtggacg acacgcagtt       300
     cgtgcggttc gacagcgacg ccgcgagcca gaggatggag ccgcgggcgc cgtggataga       360
     gcaggagagg cctgagtatt gggaccagga gacacggaat gtgaaggccc actcacagac       420
     tgaccgagag aacctgggga ccctgcgcgg ctactacaac cagagcgagg ccggtgagtg       480
     accccgcccg ggggcgcagg tcacgacccc tcatccccca cggacgggcc aggtcgccca       540
     cagtctccgg gtccgagatc caccccgaag ccgcgggacc ccgagaccct tgacccggga       600
     gaggcccagg cgcctttacc cggtttcatt ttcagtttag gccaaaaatt cccccgggtt       660
     ggtcggggct gggcggggct cgggggactg ggctgaccgc ggggtcgggg ccaggttctc       720
     acaccatcca gataatgtat ggctgcgacg tggggtcgga cgggcgcttc ctccgcgggt       780
     atgaacagca cgcctacgac ggcaaggatt acatcgccct gaacgaggac ctgcgctctt       840
     ggaccgcggc ggacatggcg gctcagatca cccagcgcaa gtgggaggcg gcccgtcggg       900
     cggagcagtt gagagcctac ctggagggca cgtgcgtgga gtggctccgc agatacctgg       960
     agaacgggaa ggagacgctg cagcgcacgg gtaccagggg ccacggggcg ccttcctgat      1020
     cgcctgtaga tctcccgggc tggcctccca caaggagggg agacaattgg gaccaacact      1080
     agaatatcac cctccctctg gtcctgaggg agaggaatcc tcctgggttt ccagatcctg      1140
     taccagagag tgactctgag gttccgccct gctctctgac tcaattaagg gataaaatct      1200
     ctgaaggagt gacgggaaga cgatccctcg aatactgatg agtggttccc tttgacaccg      1260
     gcagcagcct tgggcccgtg acttttcctc tcaggccttg ttctctgctt cacactcaat      1320
     gtgtgtgggg gtctgagtcc agcacttctg agtccctcag cctccactca ggtcaggacc      1380
     agaagtcgct gttcccttct cagggaatag aagattatcc caggtgcctg tgtccaggct      1440
     ggtgtctggg ttctgtgctc tcttccccat cccgggtgtc ctgtccattc tcaagatggc      1500
     cacatgcgtg ctggtggagt gtcccatgac agatgcaaaa tgcctgaatt ttctgactct      1560
     tcccgtcaga cccccccaag acacatatga cccaccaccc catctctgac catgaggcca      1620
     ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc tggcagcggg      1680
     atggggagga ccagacccag gacacggagc tcgttgagac caggcctgca ggggatggaa      1740
     ccttccagaa gtgggcggct gtggtggtgc cttctggaga ggagcagaga tacacctgcc      1800
     atgtgcagca tgagggtctg cccaagcccc tcaccctgag atggggtaag gagggagatg      1860
     ggggtgtcat gtctcttagg gaaagcagga gcctctctgg agacctttag cagggtcagg      1920
     gcccctcacc ttcccctctt ttcccag                                          1947
//