Dbfetch

ID   AY621108; SV 1; linear; genomic DNA; STD; HUM; 1965 BP.
XX
AC   AY621108;
XX
DT   27-MAY-2004 (Rel. 80, Created)
DT   12-DEC-2012 (Rel. 115, Last updated, Version 5)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*6802 variant allele,
DE   exons 1 through 4 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1965
RX   DOI; 10.1016/j.humimm.2011.10.013.
RX   PUBMED; 22074999.
RA   Paximadis M., Mathebula T.Y., Gentle N.L., Vardas E., Colvin M., Gray C.M.,
RA   Tiemessen C.T., Puren A.;
RT   "Human leukocyte antigen class I (A, B, C) and II (DRB1) diversity in the
RT   black and Caucasian South African population";
RL   Hum. Immunol. 73(1):80-92(2012).
XX
RN   [2]
RP   1-1965
RA   Puren A.J., Paximadis M., Mathebula T.Y.;
RT   "Distribution of HLA class I and II alleles in the South African population
RT   and its impact on the design of an epitope-based HIV-1 vaccine";
RL   Unpublished.
XX
RN   [3]
RP   1-1965
RA   Puren A.J., Paximadis M.;
RT   ;
RL   Submitted (10-MAY-2004) to the INSDC.
RL   AIDS Unit, National Institute for Communicable Diseases, 1 Modderfontein
RL   Rd., Sandringham, Johannesburg, Gauteng 2131, South Africa
XX
DR   MD5; 4616c44ab999984134bf8d12ce3ecc88.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1965
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1965
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*6802 variant"
FT   mRNA            join(<1..73,204..473,715..990,1591..>1866)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*6802 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(1..73,204..473,715..990,1591..>1866)
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*6802 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:A*68:27:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q6IV49"
FT                   /protein_id="AAT35595.1"
FT                   /translation="MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFYTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDRNTRNVKAQSQTDRVDLGT
FT                   LRGYYNQSEAGSHTIQRMYGCDVGPDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMA
FT                   AQTTKHKWEAAHVAEQWRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHE
FT                   ATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWVAVVVPSGQEQRY
FT                   TCHVQHEGLPKPLTLRW"
FT   exon            <1..73
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*6802 variant"
FT                   /number=1
FT   exon            204..473
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*6802 variant"
FT                   /number=2
FT   exon            715..990
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*6802 variant"
FT                   /number=3
FT   exon            1591..1866
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*6802 variant"
FT                   /number=4
XX
SQ   Sequence 1965 BP; 373 A; 605 C; 639 G; 348 T; 0 other;
     atggccgtca tggcgccccg aaccctcgtc ctgctactct cgggggccct ggccctgacc        60
     cagacctggg cgggtgagtg cggggtcggg agggaaacgg cctctgtggg gagaagcaag       120
     gggcccgccc ggcgggggcg caggacccgg gaagccgcgc ctggaggagg gtcgggcggg       180
     tctcagccac tcctcgcccc caggctccca ctccatgagg tatttctaca cctccgtgtc       240
     ccggcccggc cgcggggagc cccgcttcat cgccgtgggc tacgtggacg acacgcagtt       300
     cgtgcggttc gacagcgacg ccgcgagcca gaggatggag ccgcgggcgc cgtggataga       360
     gcaggagggg ccggagtatt gggaccggaa cacacggaat gtgaaggccc agtcacagac       420
     tgaccgagtg gacctgggga ccctgcgcgg ctactacaac cagagcgagg ccggtgagtg       480
     accccggccc ggggcgcagg tcacgacccc tcatccccca cggacgggcc aggtcgccca       540
     cagtctccgg gtccgagatc cgccccgaag ccgcgggacc ccgagaccct tgccccggga       600
     gaggcccagg cgcctttacc cggtttcatt ttcagtttag gccaaaaatc cccccgggtt       660
     ggtcggggcg gggcggggct cgggggaccg ggctgacctc ggggtccggg ccaggttctc       720
     acaccatcca gaggatgtat ggctgcgacg tggggccgga cgggcgcttc ctccgcgggt       780
     accaccagta cgcctacgac ggcaaggatt acatcgccct gaaagaggac ctgcgctctt       840
     ggaccgcggc ggacatggca gctcagacca ccaagcacaa gtgggaggcg gcccatgtgg       900
     cggagcagtg gagagcctac ctggagggca cgtgcgtgga gtggctccgc agatacctgg       960
     agaacgggaa ggagacgctg cagcgcacgg gtaccagggg ccacggggcg cctccctgat      1020
     cgcctgtaga tctcccgggc tggcctccca caaggagggg agacaattgg gaccaacact      1080
     agaatatcgc cctccctctg gtcctgaggg agaggaatcc tcctgggttt ccagatcctg      1140
     taccagagag tgactctgag gttccgccct gctctctgac acaattaagg gataaaatct      1200
     ctgaaggaat gacgggaaga cgatccctcg aatactgatg agtggttccc tttgacacac      1260
     acaggcagca gccttgggcc cgtgactttt cctctcaggc cttgttctct gcttcacact      1320
     caatgtgtgt gggggtctga gtccagcact tctgagtccc tcagcctcca ctcaggtcag      1380
     gaccagaagt cgctgttccc tcttcaggga ctagaatttt ccacggaata ggagattatc      1440
     ccaggtgcct gtgtccaggc tggtgtctgg gttctgtgct cccttcccca tcccaggtgt      1500
     cctgtccatt ctcaagatag ccacatgtgt gctggaggag tgtcccatga cagatgcaaa      1560
     atgcctgaat gatctgactc ttcctgacag acgcccccaa aacgcatatg actcaccacg      1620
     ctgtctctga ccatgaagcc accctgaggt gctgggccct gagcttctac cctgcggaga      1680
     tcacactgac ctggcagcgg gatggggagg accagaccca ggacacggag ctcgtggaga      1740
     ccaggcctgc aggggatgga accttccaga agtgggtggc tgtggtggtg ccttctggac      1800
     aggagcagag atacacctgc catgtgcagc atgagggttt gcccaagccc ctcaccctga      1860
     gatggggtaa ggagggagac gggggtgtca tgtcttttag ggaaagcagg agcctctctg      1920
     acctttagca gggtcagggc ccctcacctt cccctctttt cccag                      1965
//